gene PH01004637G0120
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01004637:63552 - 64251(- stand)   Name
Alternate name Locus tag PH01004637G0120
Length of gene 700  bp Length of CDS 309  bp
Product information
Feature type
CDS
Product name
heat shock protein DnaJ
Alternate name
Molecular weight
(predicted)
11434.1109199999  kDa
Isoeletric point
(predicted)
9.09727096557617
Length
102  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_189922 2
Please click OG5_189922 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 10 20 30 40 50 60 70 80 90 102
Detailed signature matches
    1. PF00226 (DnaJ)
    2. PS50076 (DNAJ_2)
    3. PR00625 (JDOMAIN)
    4. SM00271 (DnaJ)
    5. SSF46565 (Chaperone...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR24078 (DNAJ HOM...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 99751 11 67 8.08E-18 cd06257 DnaJ cl02542 -
superfamily 243077 11 67 8.08E-18 cl02542 DnaJ superfamily - -
non-specific 215804 11 67 7.17E-18 pfam00226 DnaJ cl02542 C
non-specific 197617 11 67 1.07E-17 smart00271 DnaJ cl02542 -
multi-dom 223560 11 67 1.01E-16 COG0484 DnaJ - C
multi-dom 236757 11 66 2.92E-13 PRK10767 PRK10767 - C
multi-dom 233829 11 67 7.36E-13 TIGR02349 DnaJ_bact - C
multi-dom 184611 11 67 1.73E-12 PRK14297 PRK14297 - C
multi-dom 184603 11 67 6.73E-12 PRK14282 PRK14282 - C
multi-dom 184599 11 67 1.14E-10 PRK14277 PRK14277 - C
multi-dom 184604 11 66 1.70E-10 PRK14283 PRK14283 - C
multi-dom 237658 11 67 3.94E-10 PRK14284 PRK14284 - C
multi-dom 225124 11 67 5.34E-10 COG2214 CbpA - C
multi-dom 237654 11 67 7.45E-10 PRK14278 PRK14278 - C
multi-dom 237657 11 67 7.75E-10 PRK14281 PRK14281 - C
multi-dom 172788 11 67 1.33E-09 PRK14300 PRK14300 - C
multi-dom 237661 11 67 1.63E-09 PRK14291 PRK14291 - C
multi-dom 237656 11 67 1.80E-09 PRK14280 PRK14280 - C
multi-dom 237665 11 66 2.36E-09 PRK14295 PRK14295 - C
multi-dom 184612 11 66 2.50E-09 PRK14298 PRK14298 - C
multi-dom 237664 11 67 3.63E-09 PRK14294 PRK14294 - C
multi-dom 237662 11 66 3.78E-09 PRK14292 PRK14292 - C
multi-dom 172773 11 67 4.58E-09 PRK14285 PRK14285 - C
multi-dom 172774 11 67 6.74E-09 PRK14286 PRK14286 - C
multi-dom 172778 11 67 7.78E-09 PRK14290 PRK14290 - C
multi-dom 182347 11 67 1.99E-08 PRK10266 PRK10266 - C
multi-dom 237659 11 66 3.44E-08 PRK14287 PRK14287 - C
multi-dom 236512 12 66 4.38E-08 PRK09430 djlA - N
multi-dom 237653 11 67 8.13E-08 PRK14276 PRK14276 - C
multi-dom 237668 11 67 9.40E-08 PRK14301 PRK14301 - C
multi-dom 237655 11 66 1.10E-07 PRK14279 PRK14279 - C
multi-dom 237666 11 69 1.33E-07 PRK14296 PRK14296 - C
multi-dom 237660 11 66 1.37E-07 PRK14289 PRK14289 - C
multi-dom 237667 11 66 1.99E-07 PRK14299 PRK14299 - C
multi-dom 237663 11 67 2.27E-07 PRK14293 PRK14293 - C
multi-dom 227694 12 67 6.40E-07 COG5407 SEC63 - C
multi-dom 234368 11 67 6.61E-07 TIGR03835 termin_org_DnaJ - C
multi-dom 240236 11 67 1.42E-05 PTZ00037 PTZ00037 - C
multi-dom 172776 11 66 1.84E-05 PRK14288 PRK14288 - C
multi-dom 224002 12 67 0.000527311 COG1076 DjlA - N
multi-dom 173534 11 67 0.000527875 PTZ00341 PTZ00341 - NC
multi-dom 240265 12 40 0.000994407 PTZ00100 PTZ00100 - N
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific HSP70 interaction site H38,P39,D40,K56,F59,Q60,H63,Q64 8 8 99751
 
DNA sequence
Upstream 1000 bp region from PH01004637G0120 gene.
TTTGGGTGAGAAGAATCTTTCGCAGGTGGTTAATAAGTTTGGAACTTCTCATTTTTGGTCGGATTTAATGAAAATCAAAGATCGTTTTTTTAGCTTTGGTTTATTCCAGATTAAAAATGGAATGCATACCAAGTTTTCGGAAGATAATTGGTTAGGAGATTCCTCTAAAAAGTCAATATCCGCTCCTTATAATGTGGCCAGGAGAAAGGATGATACAATAGCAAATATCCTAAGAACGATTCCTTTAAATATTTCTTTTCGATGGCCTATAATTGGTCCTAAGATACAGGCGTCGAATGAGTTAATATTGAGAATTTCTAATTTACAATTGATCTCTTAGAAAGATGTTTTCAGGTGGAATTTAAATAAATCTGGACTTTTTTCTGTACAGTCTTTTTATGCAGCATTAATTAGAAATCATCAAGCCCCCATTAGGGATTTCTTTTGGCTAATTAAAATTCCATTAAAAGTGAAAATATTCCTATGATATCTCAAAAGAGGGACAGTATTAACTAAAAATAACCTTCTTAAAAGAAATTGGAGGGGAAGTAACAAGCGTTATTTTTATATTAAAAAGAAAACAATTCAACATCTTTTTATTGAATGCCCTTTTGCACATCTTGCATGATGGGTTGTTCAATATGCGTTTAATTTATCTCCTCCTGCGAGTATAGCAAATATGTTTAAAAATTGGTTAGCCGGTATTTCAAAAATTTTAAAGTCACAACTCCTATTGGGAGCTAGTGTCTTATGTTAGTCTATCTGGTTATGTCGGAATGATGTTGTTTTTGAAAAAAAAAATATCACTAACCGTCTGTTGGTTATCTTATTGAGTTGACACTGGCTGAGGGCTTAGACAAATTTGCAAAAATCAGCCAAAAAGAGTCTATATTAGCCGAAAACGACAGGTTGAAAGTGGTGGCAAAACAAATGTTAAGCGTTCATTGGTGATGATTTAGTCACTGAATTTGTAATAATTGATTTTAATTTTTAGCCATCGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGATGCAGTCGCAGTCGCAGCCGCAGTCCTACTACGCCGTGCTTGGCGTCCACCCGGGCGCGTCCGCCGCCGAGATACGCGCTGCCTACCACCGCCTCGCCATGAGGTGGCACCCGGATAAGATCACGAGTGGCCGCATGGACACGGCGCTCGCGGAGGAAGCCAAGGGCAGGTTCCAGCAGATACACCAGGCATACCAAGGCACGTACCCAAATGTCTCTCTCGCTCGCTCTGCCATCCTCTGCCTCTCTCTCTCTCTCAGACCTTGTGTCTCTGTATTGGATGAGTACGTTAGCTTTTTTAGATAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01004637G0120 gene.
GAGTTGCCCCGAAGCAGGCGGCTGGTATATATACAGGCGCAGGCGGGAAAATATCTGCGTGCCGCGGGGAGATGGAAGAAAGGAGGAGAGGATAGACGAAGCGTTGCGAAGGGAGTTGAAGCTAGCCGGGTGGGAACGGCGCGGCGCGGGAAAGAGGGAAATATCTGGCGTCGGGAACGTTCCGGAGCGGCTTACCGGTAAAGCGGAGCCTGCCGCGTCGCCACTTCGTTCCCTGCGGTCCGGTTCTGTCGCTGTGGCCTGTGGGGGACTACCGGACTAACCTGCCTTTCCCGATGTGGGGCCCACCTGCCGGCCTCTCGCCAATGAGATTTTGATCCGGTGGGACCGGCACTTGGAGGAGCTGGCGGTGGCGAAACCAGCTTGGCCTAGTCCGCTGCGGATTCGTGTGCCCATCATGTGTGAGCTGTCTTGACTTGAAGACTTGTGCAGTTAGGCCGTGTTTGGTTAGTATTCTGTATTCTATGTCTGAGAAAAATTGGTGTCTGGAGATAGTCTGAAAAGTAGATGATTTCTGCGTAATCAGGCAAACCTGAAAATAAGTTGTTTGATTAAAAACATATGCCTGTAATTGGTGAATAAAAAATATCCGTTGAATCAAACTATTAATGGTGATCGAGCTGCTTGGAATGGTTGCCTCCCAGACGCTCGTTTTCCTAGCCTGGGCTAGCGGCTCACTCGGCTAGCAAGCAAACACAATACAGGCAGAAAGCAGGTGCTGCCCTGACCAGACAATTTGCCACTAGGCTTCCAAGCAAACAGCCTTTTAATCCTGGGTTTATCCCACGAAGTAGATCTGATGATTTGTCGTGGAACACAGATTAATATGTCTAATTGACACTGCCTACTACTCTCTCTGGTCACAAAAGTCATTTTGGGCATCATCATGATCGGCAAGAATGCAAATTTGACTAGTCATTTCTATTCTAATATATTTATAAAATCTACTAAAATTATAATATTATAAAAGTACTTTTTGAAAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01004637 Download
Protein sequence
Protein sequence
MMQSQSQPQSYYAVLGVHPGASAAEIRAAYHRLAMRWHPDKITSGRMDTALAEEAKGRFQQIHQAYQGTYPNVSLARSAILCLSLSLRPCVSVLDEYVSFFR
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above