gene PH01004446G0090
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01004446:70773 - 71661(- stand)   Name
Alternate name Locus tag PH01004446G0090
Length of gene 889  bp Length of CDS 444  bp
Product information
Feature type
CDS
Product name
hsp20/alpha crystallin family protein
Alternate name
HSP20
Molecular weight
(predicted)
16231.4042199999  kDa
Isoeletric point
(predicted)
6.86453628540039
Length
147  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_126935 7
Please click OG5_126935 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT4G10250.1
HSP20-like chaperones superfamily protein
Columbia endomembrane-localized small heat shock protein
ATHSP22.0; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to heat; LOCATED IN: endomembrane system; EXPRESSED IN: 8 plant structures; EXPRESSED DURING: M germinated pollen stage, 4 anthesis, C globular stage, petal differentiation and exp
2E-27
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 20 40 60 80 100 120 147
Detailed signature matches
    1. SSF49764 (HSP20-lik...)
    1. PS01031 (HSP20)
    2. PF00011 (HSP20)
Unintegrated signatures no IPR
Unintegrated signatures
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 107229 17 108 2.95E-25 cd06472 ACD_ScHsp26_like cl00175 -
superfamily 241659 17 108 2.95E-25 cl00175 alpha-crystallin-Hsps_p23-like superfamily - -
non-specific 215655 19 122 3.42E-21 pfam00011 HSP20 cl00175 -
non-specific 107221 19 108 9.96E-19 cd06464 ACD_sHsps-like cl00175 -
non-specific 107219 20 108 1.28E-12 cd00298 ACD_sHsps_p23-like cl00175 -
non-specific 107228 19 108 6.88E-12 cd06471 ACD_LpsHSP_like cl00175 -
non-specific 107247 61 108 9.20E-06 cd06526 metazoan_ACD cl00175 N
non-specific 107233 78 108 0.0020642 cd06478 ACD_HspB4-5-6 cl00175 N
multi-dom 223149 19 122 7.03E-13 COG0071 IbpA - N
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01004446G0090 gene.
TTTAACTTTGTAATTTTATTCTTTTTTCCCATTCGAAGGGGACGTTGTAAAACCTTTTGGTTTCCCTTTTGCTAGATAGGTCTCTCCTACCATGTGTTTGCCATCAGAATTTTAATTGGATTTTAGTTGTCTTGCTAGAGGTTGCATATGGAAACTACTGTCCAACAATTGATTGGTTTGGCTCAAAATCTGTTTTTTTTTTTTTTGCAATAGAAAAAACTATCACAGACGGTTCTTGTTCAAAACCATCTATGATGATTTCATGTTATTACTGACCCATAAACTCAGACGGCTCACGAAACCGTCTATGATGACGTTTTTGAACTGTGTGTGAAGACCTTTTCTGTAGTAGTGTTATTTCTTAGTTGTTTCGTTGTATGGATATGATGTTAACATCACTGTGTGAGCTAGCTACTGATAATGACACTAGTTCAGAATACATAGAGGGTCTGGATTTACATGTTCGAATCCCAATATAGAGTGTTTGGCTAGGTTCCGCCTGCTCCGGTTGAGAATACATGAGCAGGAACCCTACCAAACATTGTCTTAGATTCGATATCGATAGTTTTCTTGGAGTTATATTAATACAAAAAAAGATCTAATAAAACATCTAACCCTTAATTTTGTGCTCTAATTTTAAAGGCATTCAATAGTTACTATTTATAGACATATTAACTACGTTTAATTCAACGTAATTCAAGATGGAGTGTAAATTTCCTCCAAGGACACACATTTTAATCCACTCCTTCAGACGTAAGGAGAGATCTCAAAATAACATCCGCTAATTAAATATGAAATCAAATATCTCAAATTTAAACTTAGATTTCAAATTGTAAATTTGAAAATTTGAAACTAAGTAAAAATTATACTATATCAGACCGCACGGCTAAAAATTATACTATATCAGACCGCACAATTGCGCGTGCGAATCGGCTAGTTTTATATAAAGTAGTATATGCATGCTTGGGTGCGTACTTTGAACCAAGAAGACGCGACCATAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGCCGAGGACGGCGTCGGCGGCCGGCGAACCAGCCGTTGCGCTGGCGCGGTGCGATTGGAAGGAGACGCCGGAGGCGCACGTCATCGCGCTGGACGTGCCCGGGGTGAGGCGGGAGGACGTGAAGGTGGAGGTGGAGGAGAGCCGGGTGCTGCGGGTCTCCGGCGAGCGGAGGGCGGACGAGGAGAAGGAGGGCGAGCGGTGGCACCGCGCCGAGCGCGCGGCGGGGAGGTTCTGGCGCCGGTTCCGGATGCCCGCCGGGGCCGACGTCGACCGCGTCACCGCGCGCCTCGAGGACGGCGTGCTCACCGTCACCGTGCCCAAGGTCGCCGAGCACCGGCGGCGGGAGCCGCGCGTCATCAGCATCGCCGGGGATGAGGGTGTTGTCGCCGTCGGTAAGGGCGGCGCGGAGGCGGAGGTCAAGGCCACCAAGGCTGAGATGTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01004446G0090 gene.
GGGGAGAAAGGGTTTGCGAGCAATTTATACATGACGTGAGATGTGAGCTCGAGAACTCGAGATGGTTCGTTCGTAGGATTCATTTCTGGGAGCTTCTGGTGGTTTCAAGAGATGTACGTCGGTGGCGAGGGATTCCCGGAGATTCTGGAGATGTCCTTCGGCCGGTTCGGGCCTCGCTGGATAATTTGGCCCAATAGGGCGGAAACCCGTCTAAGTGAGAACGTAAATATGCTCTTGACCTGTCAAACTTTATAACATCTGACCAATAAAAAAATTCGGAAGCAAATACGGAATGCTATAGCATTGACGTGCAGGAGCAAGTTTTACGATGTTTCAAGAAGTTTCGTGACAGTATTTTAGAAGTTCCAAATTTCAGCGAGTGTCTAAGTTTTCTAGAAAAGATTCAAACTAAGTTTCAACGAGTCAGATTTTAGAACACAGGCTTCAACAAGTTTCGATCGGAGAGTTTCGAGAAGTTTCTTCACAAATTTTAAAACAAAAGTTTTAACAAGTTTTAATAGGTTTCAACAAGTTTCAAGAAGGTTGATGAGTTTCGGCTAGTTTCGGACAATTGACTTGGCTACGACGATACTGTTGCATTGCCATGAAGCTGCCCGACACCGTCTGCTGACGGTGCACCCTCTTCTCCGGCTCTGACCCCAACTACAGTCGCTGCCACGACACCGACATCGCTCGCCGTCGAATCCGTGCTCGAGCTCCATGCCCAGCATCCATCTCTCTCTCACTCTCTCCAGCCTGAGCTCTACACCACACCGCCGCCGGATCCGACCGTCTCTAGCCACGACACCACTACTCGTCGACAGATCCAGAACTAGAGGTGAAGCACTACGTCGCCACCCACTCCAAATCTAGAGCCAAAGTTGAAGGAGGTAGAGGGGCAGCGCTGGAAGTGAAGGAGGGGTGGCCACTTGCCTCTATCGGCTATACCCTCGGCCGAACACAAGAGAGGGAGAGATACAAGAGAGACAGAGAGAAGTGAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01004446 Download
Protein sequence
Protein sequence
MPRTASAAGEPAVALARCDWKETPEAHVIALDVPGVRREDVKVEVEESRVLRVSGERRADEEKEGERWHRAERAAGRFWRRFRMPAGADVDRVTARLEDGVLTVTVPKVAEHRRREPRVISIAGDEGVVAVGKGGAEAEVKATKAEM
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above