gene PH01004165G0090
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01004165:68364 - 70020(- stand)   Name
Alternate name Locus tag PH01004165G0090
Length of gene 1657  bp Length of CDS 840  bp
Product information
Feature type
CDS
Product name
Myb transcription factor
Alternate name
Molecular weight
(predicted)
29622.2510199999  kDa
Isoeletric point
(predicted)
8.46500015258789
Length
280  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_153383 8
Please click OG5_153383 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G56840.1
myb-like transcription factor family protein
myb-like transcription factor family protein; CONTAINS InterPro DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005), Homeodomain-like (InterPro:IPR009057), Myb, DNA-binding (InterPro:IPR014778), Zinc finger, CCHC-type (InterPro:IPR001878), HTH transcriptiona
3E-44
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g41900.1 Myb transcription factor, putative, expressed 5E-110
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 280
Detailed signature matches
    1. PS50158 (ZF_CCHC)
    1. SSF46689 (Homeodoma...)
    1. PF00249 (Myb_DNA-bi...)
    2. SM00717 (SANT)
    1. PS51294 (HTH_MYB)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0008270 zinc ion binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238096 122 167 9.87E-09 cd00167 SANT cl17250 -
superfamily 247804 122 167 9.87E-09 cl17250 SANT superfamily - -
non-specific 130620 118 170 2.24E-16 TIGR01557 myb_SHAQKYF cl17250 -
non-specific 197842 120 169 1.77E-08 smart00717 SANT cl17250 -
non-specific 215818 122 165 4.97E-08 pfam00249 Myb_DNA-binding cl17250 -
non-specific 212558 121 158 9.81E-05 cd11660 SANT_TRF cl17250 C
non-specific 212559 123 159 0.00144138 cd11661 SANT_MTA3_like cl18297 C
superfamily 212559 123 159 0.00144138 cl18297 SANT_MTA3_like superfamily - C
multi-dom 227445 123 198 0.00119885 COG5114 COG5114 - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site W123,R154,T155,T157,Q158,A160,S161,H162,Q164,K165,F166 11 11 238096
 
DNA sequence
Upstream 1000 bp region from PH01004165G0090 gene.
TCCAAATCTCGCCCCTGCGTGATGATCCATGGTCCCCTGGCTGGGGGATCCTCGGCAGGGCACCATGGACATCGACGACACCGAGAGCTCGATCGTCATCCTGGATGCGCCCATAGGGTTTATTTCGATCCATCCCGATTGTCATGGCGTCGAGGCTGGTTAGTGCGTAAAACTCAGCTCAGCTCGAAGAAAATGGGGGATATCTGCAGTTTCTCTATGGGTAGCACCGTGGAATAAAGCGGCATACTCCTTTTTTGCTTTAGACATGATAAGCTTCCTACAAGCAAAGCAGACACTGTTTGCTGCCAAGTGCCGCAAACCAGGGCATACGTGCGTCATCATTCAAAAGCAATGTGCCATATGTTGCTGCCACTGGAACGTTGGGACAATACCACTGTACTGGATAAGCACCAACCCTCCCATCTTTTCCCTTCTCGGCAACAACTTACTCTGCATACAGTAGCAAGCTAGCAAGAAGAGAAGAGAGATGTTTCTTTCTACATGTCTTAATTTGCATCAATAGATGCATCATCAGCCGTGACAAGGATATGGCAGCCCAATCGAGACGGCAACTTGGCACCGTTCAGAGGCAACAGTACTACATGGATGAATCTGGACTGCATATGATCTGTGGATCCGGGGTTGTACGTAGGACTCTCCCATAGGATGATACGATGCAGGCACCACACAATGTTGCTAGCCATCTGAATTGAATCTGCTTGTCATGGCCTGTGGATGGATGTACGAGTGGTGTCTGTCATGGTAAGCACTAGACAGAAAGGTGCAAGAGGATAAGAATCTGAAAAAAGGTTATATTTTTCTCTTGTCGAACGAATTACGCATATGTAGCTAGACTGCTGAAAATGAAATGTAAAAGCTAAATTAATTTATACGCGACATGCTACTGTTATGTATGTGATTTGAGGTGAGAAAAGAGAAGAAAATTAATCGCAAGCAAGGTCTATGATTGGAGAATGAATAGGGCACGCAGGGGCAGAATT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGAGGAAATGCTCCCACTGTGGCAACTACGGCCACAACTCAAGAACCTGCAGCACAGGACAGAGAGAAATTATGATCTGCGAAGGAGGCAGTAGCAGTGGTGGTAGTGGTGGTGGTAGCAGTGGGCTAAGGCTCTTTGGGGTGCAGGTCCATGTCGCTGCAGGCGCCGGCGCGTCCATGAAGAAGAGCTACAGCATGGACTGCCTGCAGCTTGCGGCTCCCAGTTCCCTCGTCTCGCCTTCGTCGTCGTCTTCGTCGTCGCTACTTCTGTCGATCGATGAGGGCCTGGAGAGGGCGTCCAATGGTTACCTTTCTGATGGCCCTCATGGCAGAGTAGTCCAGGAGAGGAAGAAAGGAGTTCCATGGAGTGAGGAGGAGCACCGGCTGTTCCTAGTCGGCCTTGAGAAGCTCGGAAAGGGCGACTGGAGAGGCATCTCTCGGAGCTACGTCACGACGAGAACTCCGACGCAGGTCGCCAGCCATGCACAGAAGTTCTTCCTGAGGCAGAGCAGCATGGGGAAGAAGAAGCGCCGGTCCAGCGTCTTTGACATGGTACCGATTTGCGAGAACGGCGTAAGCGTTTCTGAGCCATTGAACAGCGGCGAAGGTGCCTCGACTTCTCTTTCGCTGAACATGTCGCGCCATGAATCCTCCAAAAGGGCAGCAATTGATCTGAATTCTACGGAGGAAGATGACAAGGTGGATGTTTCATCGGCTTCAGGTGCATCAGCAAGGCCATTCCCTGTGGTTCTGATGGAGCAGCCTTCTCATGGTCACCACTGCAATCCACTGGACTTGGAACTGGGCATGTCTCTGTCCACGCCGTCCATCGGAACA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01004165G0090 gene.
ACCCACTATAAATATGCTCCTGGCAATGGTCTTTTGGCTATGGATGTGGACATGCAGGAAACCATAGAAAAATAATTATCGAAGTCGCCTTCCAGATCTTGTAGCTTGGACCTCGTTGCTAATATGATTGGCTAAGTATCCCTTGTATATAGGAGCACTACTATGTGCATGAACAAACTCTCTACGATTGTTACCAATTGTCACCCAAACATGGGCCTGTTGATCGGTGTAATTTACACGGGCCCACTTGTCAGAGATATTATGTGATGTTTTTTTTGTGTGTGTGTGTGCGTGTGTGGAAAATAGCCTCATACACGAGGCACTTGTGTAAATATAAGTTGGTCGACCCAAAGAATTCATGCATAAATCTATTTTCCAAAAGCAAAACAAGAATGCGCATACGCACTAGCGAAGATGAAGAATAGGAAAGTTTACACGAGCAACAGAATGTTCCTGGAATTCGCTGCAAGTGTAAGCGCGCAACACTAGCAATGCGTTCACTTATCTACCAAAACATTTTCAAAGAAACAGGGACCACGAGGAAACTGTGCTTTACTTTGCTTAATTCGTAAGCGTAGCAGATCTGCGTTTGTGATTGAATTTCAAGCTAATTAGCCTATCTATGTAAATTGTGAGACCATGTAGAGGTCACTACATGGTTTGTGATGAGTATTTGACTCTTTGGTTTGATTGGTTTTGGATTTTAAAGCTTGTTTTTGGAAAGAGTAAAAAGATTTGAGGTTGGGGCGGATCATCCGGGTGGGTCGGACCTTTGGGTCAAATCATTGATCCAAAGAGCATTCGAGGTGAAGAGAGTGTGAGTTAGATCATTCAGGTGAGCCGAACCATTGGCCCAGCGAGTCCATGGTTTCAGGATTGTTTGGGGTGGATCATCCGGATCACCCGTACCAATGAGACGGCGGACCATTGCTCCAGCAAACATGTTTTTGGAGTTCTAAGCCATTTTGAGGGTTCGGTCGATCCGGTGCCCATGGGGCCTT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01004165 Download
Protein sequence
Protein sequence
MARKCSHCGNYGHNSRTCSTGQREIMICEGGSSSGGSGGGSSGLRLFGVQVHVAAGAGASMKKSYSMDCLQLAAPSSLVSPSSSSSSSLLLSIDEGLERASNGYLSDGPHGRVVQERKKGVPWSEEEHRLFLVGLEKLGKGDWRGISRSYVTTRTPTQVASHAQKFFLRQSSMGKKKRRSSVFDMVPICENGVSVSEPLNSGEGASTSLSLNMSRHESSKRAAIDLNSTEEDDKVDVSSASGASARPFPVVLMEQPSHGHHCNPLDLELGMSLSTPSIGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above