gene PH01002673G0070
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01002673:47490 - 53632(+ stand)   Name
Alternate name Locus tag PH01002673G0070
Length of gene 6143  bp Length of CDS 1203  bp
Product information
Feature type
CDS
Product name
OsSPL16 - SBP-box gene family member
Alternate name
Molecular weight
(predicted)
42694.83682  kDa
Isoeletric point
(predicted)
7.57024002075195
Length
400  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_160420 6
Please click OG5_160420 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os08g41940.1 OsSPL16 - SBP-box gene family member, expressed 8E-135
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 300 350 400 400
Detailed signature matches
    1. SSF103612 (SBT domain)
    2. PS51141 (ZF_SBP)
    3. PF03110 (SBP)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding

Cellular Component

GO:0005634 nucleus

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 190527 97 174 2.08E-51 pfam03110 SBP cl03894 -
superfamily 190527 97 174 2.08E-51 cl03894 SBP superfamily - -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01002673G0070 gene.
TGTTCAGATTTCAGACAGCACTTGGACCAATTGTATACTCCTTCGTTAGATGAAATAAGGGTTGTTTAGTTGATGGCTAATGTAAGCTAAGCTAAAATTTTGGCATAATCAAAATATAGACAAAGCCAAATATTAGCAGAAAAAACGTTATCTGGATTATGGTCAAGCCAAATTTTGGCGTTATCAATATTTTGGTGATTGATTTTCTCACACTTGAATTACTCGCGTGTGACATTGGATTTCATTGGTGTTACCGAATTTTTGTGAACGTTACCAAATTTTGATAGCAAACTAAGTGATAACTAATTTTCATTGATATTAACAATATTTGATTTAGTTTAAAAGTACCAAACCAAGCCGCCCTAGATCACTTATCCCATAAAATGATAAAATAAAGCCCAGTGGCACTAAAAAACAATACATGCATTCCTTTGCCATTCCCAACCAGTCAGCCCTAGTGACCAAGCCCAAACCAACCCCCTCGCCCCAATAATTGTAGCACAACCCTTTCCATGCCAGTGTTGAACATGGCTCTGAGGGCCCCTTCCCCCATTTACTGTTCCTCCCTTGGAATGCCTGTCAGGGATAGGGATTGAATGGCTGCAACCCCAGAGACCCCAAATAATAGAATACCCCCCCACCCTCTCAAATACACACACAGTCCGTTGCTACAGTTCCAGTTGCACCTGCAAGTACTGATCGACTACCCCAGTTCCTGGCCTCTTGGCCTTGGTATTGTTGCTGCAAATCTTTGTTGGTTGCTACAATCTATTTAGCTCAACCTCAGCACACTGCACCCTCCCCCCCTGGATATTGGATAAGCCTCCCCTGCTCCTTTATTATACAGTATCTCTTTCTTTCTCCCCTTGTTAGATGTGCACATGTGCACTGCCTTTTGAAGCTTATTTTTTTTACTTGACATCTTTGGATTGGTATGACAATTAACCCATAGATCTAGTACAAGTAGGCTACTGCTACTACTTGTAGTCGCTCCTTGCAAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGATTGGGATCTCAAGATGCCGCCCGCCTGGGACCTCGCCGAGCTGGAGCACGACGCGGCCGCGGCGTCCTCTGGCATTACTGCCGCCGGCCGGCCCGAGTGCTCGGTCGACCTCAAGCTCGGTGGGTTGGGCGAGTTCGGCGCCCCGGCGGCGGCTGCGGACAGCCGCAAGGAGCCCGCGCCAGCCAAGGTCCCTGCCGCGGCGTCGCCCAGCCCGGCTAAGCGGCCGCGCCCGTCGGGCGGGGGCGGTGGGAGTGGGAGCGGAGGCGCGGGGCAGTGCCCGTCGTGCGCGGTGGACGGGTGCAAGGCGGACCTGAGCAAGTGCCGCGACTACCACCGGCGGCACAAGGTGTGCGAGGCGCACTCCAAGACGCCCGTCGTCGTCGTCGCCGGCCGCGAGATGCGCTTCTGCCAGCAGTGCAGCAGGTTTCACTTGCTTGCGGAGTTTGATGAGGCCAAGCGCAGCTGTAGAAAGCGCCTTGATGGGCACAACCGTCGCCGCAGGAAGCCACAGCCAGATACCATGAATTCTGCAAGCTTTATCACGAGTCAACAAGGAACAAGGTTCTCATCATTTCCAACTCCAAGGCCGGAGCCAAACTGGCCAGGGATCATTAAAACGGAGAGTCCGTATTACACACATCAAATCCCTCTTGGTATCAGCAACAGGCATCATTTTGTTGGCTCTACATCAACTTACACCAAAGAAGACCGGCGCTTTCCTTTCCTACAGGAAGGCGAAATAAACTTCGCCACCGGTGTAGCGCTTGAGGCTTCAGTGTGCCAACCACTCCTCAAGACGGTAGCTCTTCCTGAGAGCAGCAGCAGCAGCAGCAAGATGTTCTCTGATGGGTTGACTCCAGTGCTCGACTCGGATTGTGCTCTCTCTCTTCTGTCAGCTCGAGCGAATTCCTCTGGTGTCGATGTCAGCAGGATGGTCCAACCGACTGAACACATCCCCATGGCTCAACCTCTGGTATCCAGCCTGCAATTCAGCAGCTCATCCTGGTTTGCGCGCTCTCAGGCTTCAACCGGTGCGGTCTCGACGGCTGGATTTTCCTGCCCTGTAGTGGAAAGTGATCAGCTGAACACTGTCATAAGCTCGAATGACAATGAGATGAACTACAATGGGATATTCCATGTCGGCGGTGAAGGCTCCTCAGATGGCACCTCACCGTCTCTACCCTTCTCATGGCAGTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01002673G0070 gene.
ATCAGCAGCATAAATCAGTTCCTCGGAATCTTTTTGAATTATGGTGTCTAGTGTCATTTGCAGTATTCAACCATGATTACATTTCGTCTAGCGATTGTTCATACTATATTTACAATGCATTTGCAGTGACGAGGATTAATTTTAGGGTATTGCTAGCAGTCGGACGTACGGGTTGGAATTCCTATCCGTACGCACAGATGTAGTCAATGCCTCCCTTCATAGACTTGATAATTATTTAAGGAACTAAAGTATAAGCGTATTTGAGACATTGACACAAGCTACCTTATCATAGACTTTGACGTTTTACTCATTCATTTTCATCGTTATACGGAATTACTCAACAGAGAAGGGATGGGGATAAATTCGGGATTCTACTCCAACGGTCGCTTATTTAAGTACGTACTAGTAGCCCGGACGCGCCTTTAGGCGCGCGTGTTTTTGATTGAAGGAACTTACGCACGGAACGCACGGCGTTGTCGTACGGCCGGATTAGGAGTCGGATGTATGGGTGGGAGTTCCCACCCGTACGGTCCTCCCGTATCGACGTCTAGATGTAGTACAACCGTTCCATCATTAAAAGGTGCATGTATATGATGCACAAGACACAAGGATATGTGTCTGACGCACATGAGGGACTGCACATATATGTACATGTATACATCGCAGTTGTAATTTATATGAGTAATCACCATAAAAGATTTTAGTATAAAAAAATCGCAAAACCACTAGGCATGCAACTTCCTAGGACAACGGTTGCAACATCCCCGGACAACGGTTGCAACATCCTAGGACAGCGGTTGCAATATCCCCAAACAACGGTTGCAACATCACCGGACAATGATTGAAACATCCCCCGAACACGGTTGCAACATCCTAGGACAATGGTTGCAACATCTCCGGACAACGGTTGCAACATCCTAGGGCAATGGTTGCAACATCTCTGGACAACGGTTACAACATCTTAGGACAACGATTACAATGCAACATTTTTTTATACGGGG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01002673 Download
Protein sequence
Protein sequence
MDWDLKMPPAWDLAELEHDAAAASSGITAAGRPECSVDLKLGGLGEFGAPAAAADSRKEPAPAKVPAAASPSPAKRPRPSGGGGGSGSGGAGQCPSCAVDGCKADLSKCRDYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQPDTMNSASFITSQQGTRFSSFPTPRPEPNWPGIIKTESPYYTHQIPLGISNRHHFVGSTSTYTKEDRRFPFLQEGEINFATGVALEASVCQPLLKTVALPESSSSSSKMFSDGLTPVLDSDCALSLLSARANSSGVDVSRMVQPTEHIPMAQPLVSSLQFSSSSWFARSQASTGAVSTAGFSCPVVESDQLNTVISSNDNEMNYNGIFHVGGEGSSDGTSPSLPFSWQ
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above