gene PH01002641G0230
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01002641:146324 - 151029(- stand)   Name ribH
Alternate name Locus tag PH01002641G0230
Length of gene 4706  bp Length of CDS 1023  bp
Product information
Feature type
CDS
Product name
6,7-dimethyl-8-ribityllumazine synthase, chloroplast precursor
Alternate name
RIB4
Molecular weight
(predicted)
36237.98372  kDa
Isoeletric point
(predicted)
9.77835464477539
Length
340  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_128902 1
Please click OG5_128902 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os04g42000.1 6,7-dimethyl-8-ribityllumazine synthase, chloroplast precursor, putative, expressed 3E-63
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
    1. MF_00178 (Lumazine_...)
    2. PF00885 (DMRL_synthase)
    3. SSF52121 (Lumazine ...)
Unintegrated signatures no IPR
Unintegrated signatures
GO term prediction

Biological Process

GO:0009231 riboflavin biosynthetic process

Molecular Function

None predicted.

Cellular Component

GO:0009349 riboflavin synthase complex

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
KEGG orthology Functional Subsystem Pathway
Metabolism Metabolism of cofactors and vitamins Riboflavin metabolism  
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
ID for KEGG orthology Reaction description EC number
K00794 6,7-dimethyl-8-ribityllumazine synthase EC:2.5.1.78
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 187742 89 177 1.86E-42 cd09209 Lumazine_synthase-I cl00317 C
superfamily 241778 89 177 1.86E-42 cl00317 Lumazine_synthase-like superfamily - C
non-specific 178026 78 180 3.71E-60 PLN02404 PLN02404 cl00317 C
non-specific 234606 80 180 8.22E-45 PRK00061 ribH cl00317 C
non-specific 201491 83 180 1.34E-40 pfam00885 DMRL_synthase cl00317 C
non-specific 223132 83 180 8.66E-39 COG0054 RibH cl00317 C
non-specific 211550 85 180 1.38E-31 TIGR00114 lumazine-synth cl00317 C
non-specific 187740 89 178 4.27E-19 cd08371 Lumazine_synthase-like cl00317 C
non-specific 187744 89 170 4.64E-16 cd09211 Lumazine_synthase_archaeal cl00317 C
non-specific 187741 102 180 7.28E-12 cd09208 Lumazine_synthase-II cl00317 C
non-specific 237096 75 204 1.23E-10 PRK12419 PRK12419 cl00317 C
non-specific 178026 295 331 5.19E-06 PLN02404 PLN02404 cl00317 N
superfamily 241778 295 331 5.19E-06 cl00317 Lumazine_synthase-like superfamily - N
non-specific 234606 295 336 0.000419517 PRK00061 ribH cl00317 N
non-specific 187742 295 332 0.000839816 cd09209 Lumazine_synthase-I cl00317 N
non-specific 201491 295 336 0.00480274 pfam00885 DMRL_synthase cl00317 N
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific active site F94,N95,G127,S128,F129,E130,G151,A152,V153,I154,R155,G156,T158,H160,Y161 23 15 187742
specific homopentamer interface F94,V123,S124,V125,P126,F129,E130,P132,V133,A134,Q136,K137,L138,K140,F144,R155,D157,T158,H160,D162,A163,A165,N166,S167,A169,S170,G171,L173,N174,A175,G176,L177 46 32 187742
generic active site I297,F298,L310,R312,K320,A324 21 6 187742
generic homopentamer interface P295,F298,D304,Q308,R312,K320,E323,T327,E330 42 9 187742
 
DNA sequence
Upstream 1000 bp region from PH01002641G0230 gene.
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGTGCCGTGCCGTGCCGGCCCACCGTGCCGAGGTGGCGGCCCAGGCACGGCCCAGGGTCTTGTGCCGGGCCGGCACGGCCCATGAACAGTGCGGGCCATGCCGTGTTTAGGCCGGACCTACAGTAGCGTGCTTCGGGCTGGCCTATTTGGCCCGCCCCATTTGGCCAGCTCTAGATCCGACTGAGCGTGAGCGGTCCAGAGTTTTACAAAAAGAACCTCCACTGACTCAGTATTACATTCCTCTGTTACTGTTCTACACCGTCCCACCAAGGCTCACCCACCCGACATGTGTTCGAGCAAATGCCCATTCCACACGTCCACCGCGCGCTCGCCCACGCCGCCGCACTGGACCCGACCCGACCACTCGTATGGCTGTTCTGTCGCTCCGCAACTGACGCCGAGAAACTATGAACCCATGCCAAGAGCCTGCCCGCGGCGAGAGACGGGGACCAACGGCGGCCAGTACGCGCCGCGGAAGATGCGGCTGCGCGGGACCGCTGCTCCGGGGGCAGCCGGTCGGGTCGACGGTGCCAGTGCACGAGAACACACGCAGAGCCTTAAACCTACAGGGCGCCGTGACAGTCGCTTACGTCCGGGCAGCGCGTGGCGTCCACGTCGTGCCACCGAGCCTGCGCTTCCCCGTGGACGGCTTATCCCGCTCGCAACCACGGCGCCGGGAAGGTGCGTAGGGAGCAAGGGGTCAGCTGGTCGCGCGCGCACGCCGCGCCGAGCTTGTCTGCTCACCAACCGCATGCGAGCGGGACCAGTTTGCGCAGCTTGTGTACGAGTCTGCTCAGTTCTCTAACGGGCGTGATCGGGATTCATGCCACCTCATTTCATCGACTTCGATTACCAACCAAAAGAAGGTGATGCAGAGTTCTCAGCCATGAAAACACAACGTAATGTGGCTTTATTCATGACCATGTACCGTACTTGGTAAAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGGCTTCACCAGCGACATCATCCGCGGCCGCGGGGCCCTCCTCCTACCCATGGCTATCCAACGCGCCTCTGCGTGCGCCGAGAGCCGCCGCCGTCTCCTTCCCTTCGTGCCCCTCCCGTACGCGCGCACCGTTACCCTCTCGTCCCGCCGCGCTGGTCGCAGATGCTCGGGCTTCTCGGCGCCCCGTCGTGGCCGCCGCCGCCGCCGGGCGCCAGCGGCTGATGGGGTCGCTGACCAACAACGAGGGGCTCAGGTTTCGAGTGGTTGTGGCACGGTTCAATGAGATAGTCACAAACTTGCTACTGCAGGGGGCTCTAGAGACATTCGAGCGATATTCCGTCAAAGAAGAAAATATAACGGTTGTTAGTGTTCCTGGCAGCTTTGAAATTCCTGTTGCCGCACAGAAGCTTGGGAAGTCTGGAAAATTTGATGCAATTATTTGCATTGGGGCTGTGATTAGAGGTGACACAACCCACTATGATGCTGTTGCAAACTCTGCTGCATCAGGTGTGCTCAATGCTGGACTGTCTGCTGGTCAACTGACACTTAGAAGCTATGTTGTCCCGATACGCGATACCGAAAATGCAACAATCAGTCAATCACTGACCTGGATCGAGAAGGAGGACCGGAGGAGGAATGCACTCGAAGCGGCGTTGGGCAGAGAGGAGGAGCGGCGGTGGCAGAAAGGGAGGAGAAGCGGTGGCAGAAGCAAAGAGGAGGAGAGAGGAGGGGCAGCGGAGGGAGGAGGTGCGGCGAAGGGGGAGGAGCAGTGGCGGAGGGAGGAGGGGCGGCGGCCTCAAGATGGCTTGGAGGAGGAGGTGCGGCTGCGCGTGTGTAGGAGAAGGGGCGGCTGCGCGTATGGAGGAGGGTCTAGGGTCCCTTGCATATTTGGTGTTCTGACCTGTGATGACATGGACCAGGCGCTAAATCGTGCTGGTGGCAAGGCTGGAAACAAGGGTGCTGAAGCCGCTCTAACTGCTATTGAGATGGCCTCGTTGTTTCGGCATCACTTAGGCTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01002641G0230 gene.
CGCCGCTGGTGGGTGCAAAGGAAGATCTGGCAGCTGCTTCTCTACTCTACTCTAGCGCGGATAGAGCTGGGACTCGGGCCGGGCTTTTCCGGGTCGGCACGAGGCCCGGCCGGCGAGGCACGGCCCAGACACGGCACGGCACGCCACGTGGCGGGCCGTGCCAGCACGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCCGCACCGCGCCGCGCCCACGACGCCGCGCCGCGCTCGCCCTCGCGCTCCACGCCCGCTTGGCCGTCTTCGCGTCGCGTCGCCGCCCGAGTCCCAGCTCTAGCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01002641 Download
Protein sequence
Protein sequence
MAASPATSSAAAGPSSYPWLSNAPLRAPRAAAVSFPSCPSRTRAPLPSRPAALVADARASRRPVVAAAAAGRQRLMGSLTNNEGLRFRVVVARFNEIVTNLLLQGALETFERYSVKEENITVVSVPGSFEIPVAAQKLGKSGKFDAIICIGAVIRGDTTHYDAVANSAASGVLNAGLSAGQLTLRSYVVPIRDTENATISQSLTWIEKEDRRRNALEAALGREEERRWQKGRRSGGRSKEEERGGAAEGGGAAKGEEQWRREEGRRPQDGLEEEVRLRVCRRRGGCAYGGGSRVPCIFGVLTCDDMDQALNRAGGKAGNKGAEAALTAIEMASLFRHHLG
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above