gene PH01002494G0310
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01002494:168417 - 173441(- stand)   Name
Alternate name Locus tag PH01002494G0310
Length of gene 5025  bp Length of CDS 873  bp
Product information
Feature type
CDS
Product name
hydrolase, NUDIX family, domain containing protein
Alternate name
Molecular weight
(predicted)
32414.2872199999  kDa
Isoeletric point
(predicted)
5.26700973510742
Length
290  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_130421 6
Please click OG5_130421 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G47650.1
nudix hydrolase homolog 2
Encodes an ADP-ribose pyrophosphatase that confers enhanced tolerance to oxidative stress.
nudix hydrolase homolog 2 (NUDT2); FUNCTIONS IN: hydrolase activity, ADP-ribose diphosphatase activity, NAD or NADH binding; INVOLVED IN: response to oxidative stress; LOCATED IN: cytosol; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 12 growth sta
8E-114
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os06g42790.2 hydrolase, NUDIX family, domain containing protein, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
  1. Domain
1 50 100 150 200 250 290
Detailed signature matches
    1. PR01356 (GFGPROTEIN)
    1. SSF55811 (Nudix)
    1. PF00293 (NUDIX)
    2. PS51462 (NUDIX)
    1. PR00502 (NUDIXFAMILY)
    1. PS00893 (NUDIX_BOX)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0016787 hydrolase activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 240027 116 245 6.71E-59 cd04670 Nudix_Hydrolase_12 cl00447 -
superfamily 241868 116 245 6.71E-59 cl00447 Nudix_Hydrolase superfamily - -
non-specific 215841 116 240 1.02E-22 pfam00293 NUDIX cl00447 -
non-specific 239217 118 238 5.08E-19 cd02883 Nudix_Hydrolase cl00447 -
non-specific 239643 116 242 4.36E-13 cd03671 Ap4A_hydrolase_plant_like cl00447 -
non-specific 239647 118 230 4.50E-12 cd03675 Nudix_Hydrolase_2 cl00447 -
non-specific 223979 117 232 7.59E-12 COG1051 COG1051 cl00447 -
non-specific 240030 118 232 3.88E-11 cd04673 Nudix_Hydrolase_15 cl00447 -
non-specific 240028 120 183 3.95E-11 cd04671 Nudix_Hydrolase_13 cl00447 C
non-specific 240032 117 177 1.01E-10 cd04676 Nudix_Hydrolase_17 cl00447 C
non-specific 239645 127 227 1.59E-10 cd03673 Ap6A_hydrolase cl00447 -
non-specific 240033 120 240 1.58E-09 cd04677 Nudix_Hydrolase_18 cl00447 -
non-specific 234820 116 183 2.25E-09 PRK00714 PRK00714 cl18874 C
superfamily 234820 116 183 2.25E-09 cl18874 PRK00714 superfamily - C
non-specific 240034 117 184 5.23E-09 cd04678 Nudix_Hydrolase_19 cl00447 C
non-specific 240055 121 182 5.32E-09 cd04700 DR1025_like cl00447 C
non-specific 240029 118 227 8.45E-09 cd04672 Nudix_Hydrolase_14 cl00447 -
non-specific 240036 120 228 1.12E-08 cd04680 Nudix_Hydrolase_21 cl00447 -
non-specific 239520 147 184 2.98E-08 cd03428 Ap4A_hydrolase_human_like cl00447 NC
non-specific 239517 120 233 3.43E-08 cd03425 MutT_pyrophosphohydrolase cl00447 -
non-specific 240022 145 231 7.59E-08 cd04664 Nudix_Hydrolase_7 cl00447 N
non-specific 240043 117 233 8.69E-08 cd04687 Nudix_Hydrolase_28 cl00447 -
non-specific 240054 120 229 1.35E-07 cd04699 Nudix_Hydrolase_39 cl00447 -
non-specific 240037 120 229 1.78E-07 cd04681 Nudix_Hydrolase_22 cl00447 -
non-specific 223568 123 245 2.07E-07 COG0494 MutT cl00447 -
non-specific 239519 142 174 6.18E-07 cd03427 MTH1 cl00447 C
non-specific 240053 152 228 6.53E-07 cd04697 Nudix_Hydrolase_38 cl00447 N
non-specific 240048 152 230 7.95E-07 cd04692 Nudix_Hydrolase_33 cl00447 N
non-specific 239521 152 230 1.56E-06 cd03429 NADH_pyrophosphatase cl00447 N
non-specific 239646 118 230 4.68E-06 cd03674 Nudix_Hydrolase_1 cl00447 -
non-specific 182721 126 182 1.28E-05 PRK10776 PRK10776 cl00447 C
non-specific 240038 145 230 1.60E-05 cd04682 Nudix_Hydrolase_23 cl00447 N
non-specific 240040 120 227 2.22E-05 cd04684 Nudix_Hydrolase_25 cl00447 -
non-specific 240042 147 189 2.26E-05 cd04686 Nudix_Hydrolase_27 cl00447 C
non-specific 239516 146 230 2.51E-05 cd03424 ADPRase_NUDT5 cl00447 N
non-specific 240031 143 185 2.79E-05 cd04674 Nudix_Hydrolase_16 cl00447 NC
non-specific 240041 147 232 3.30E-05 cd04685 Nudix_Hydrolase_26 cl00447 N
non-specific 240039 145 175 5.44E-05 cd04683 Nudix_Hydrolase_24 cl00447 NC
non-specific 240052 118 232 5.57E-05 cd04696 Nudix_Hydrolase_37 cl00447 -
non-specific 240049 145 228 5.63E-05 cd04693 Nudix_Hydrolase_34 cl00447 N
non-specific 236516 145 176 5.92E-05 PRK09438 nudB cl18893 NC
superfamily 236516 145 176 5.92E-05 cl18893 nudB superfamily - NC
non-specific 240044 117 234 6.35E-05 cd04688 Nudix_Hydrolase_29 cl00447 -
non-specific 239948 144 229 6.57E-05 cd04511 Nudix_Hydrolase_4 cl00447 N
non-specific 239518 149 239 7.40E-05 cd03426 CoAse cl00447 NC
non-specific 240023 147 188 9.90E-05 cd04665 Nudix_Hydrolase_8 cl00447 C
non-specific 240035 117 183 0.00010911 cd04679 Nudix_Hydrolase_20 cl00447 C
non-specific 240046 118 175 0.000110903 cd04690 Nudix_Hydrolase_31 cl00447 C
non-specific 239644 121 175 0.000126693 cd03672 Dcp2p cl00447 C
non-specific 182536 145 175 0.000148489 PRK10546 PRK10546 cl00447 NC
non-specific 240026 119 183 0.000247267 cd04669 Nudix_Hydrolase_11 cl00447 C
non-specific 215184 117 182 0.000281707 PLN02325 PLN02325 cl18324 C
superfamily 215184 117 182 0.000281707 cl18324 PLN02325 superfamily - C
non-specific 226604 142 227 0.000394009 COG4119 COG4119 cl00447 -
non-specific 240025 140 229 0.000623909 cd04667 Nudix_Hydrolase_10 cl00447 -
non-specific 240021 150 174 0.00152914 cd04663 Nudix_Hydrolase_6 cl00447 NC
non-specific 240020 144 187 0.00199097 cd04662 Nudix_Hydrolase_5 cl00447 NC
multi-dom 225373 152 227 1.44E-06 COG2816 NPY1 - N
multi-dom 185291 152 231 3.67E-05 PRK15393 PRK15393 - N
multi-dom 235436 117 232 3.85E-05 PRK05379 PRK05379 - N
multi-dom 236361 114 175 4.24E-05 PRK08999 PRK08999 - C
multi-dom 131752 141 173 0.000249359 TIGR02705 nudix_YtkD - NC
multi-dom 183303 125 173 0.00329615 PRK11762 nudE - NC
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific nudix motif G152,V153,V154,E155,P156,G157,E158,D159,I160,N161,I162,G163,A164,I165,R166,E167,V168,K169,E170,E171,T172,G173,I174 23 23 240027
 
DNA sequence
Upstream 1000 bp region from PH01002494G0310 gene.
GAGGGAATATAAGTTTAAGGTAGGTCGCACATGGTACATCGGTGTATGCGTAAGAAAGATACTCTAATACCATATAAACTAATAAGATAATTTGCCTCACACATAATCAACGTATTTCTTGATATTAAATAGAGGTACATGTGCATGCGTAATTTTTTTTTGTTTTGAAAAAACAACTAATAGAGTAAGAATAGGGTCGTGCAGCTACATGATCTATGTATGATGGAAAGTTGTTAGTTTCTAAGAACTCAACAACTTATTATATTCAATGATTTTCTTCCATCAAAACTTATACTTCAATTACATTCCTTAGGCCGTAATTTCCTTCAAGCTTCTATTGACATTTTCAATGTTTAGGATATATTTAAAATCTAAATAGACTACAAGATACGTAAATATATTCTCAAGCGTTTATATAAAACTTCAAAACAAATTGAGCCGCGCAAATGCGCGGGCTATCCTACTAGTTCGAGGTAAATTGAGGTAATTTGGGGAAGAGCGCAGGAGAAATAGAAAGGGGGCTATGAAGAAGAAGAACAGTAGAGGTAGAACTCAATATTTCATTTCATCCATGCGTTTTCTTAGACACACAATTACATGATCTCTTATACTCACCAACACACACTGCCCATTGGGACCCAGCGCCCATGGACCAGGCGCACGCACACAGCATACAGGACCTCTTCTGACTTCTCATCTGCCTGACCCCACTTGTCTGCTTCCTCCGGCGCAGGTGTGACAGCGCACTAAAACAGTTAAAAGACGTGCGCCCACACAGTGAGGTCACGAGTCTGACTCTACGAAGAGAACTGTTTTCCTGTGCCAATGTCAAGATCGACACTTTTTTCGGAAGAAAGTAGGATAGCAACATCTGATGCAAGAGGTAGACGATCAAGATCAACCAAGAATAACGCATAGCAAAATTCTGGTCTAGATCATCTCCAAATTATGACCAGTAGACCTGGTAATGCTAGCTTGACTGCAATAGCATAGTAGAATGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGTCAAGTTCTACCAATTCAACAGTGGTGGCAGAGTCGGCTTTGACTGAGAAGGCTGGGGATGTCGAGATGCTACCTTTCGTGAATGACATACATGGAGGTGTCATTATTGAGATGACTACCCCAATGGATCCCCAAGTGTTTTCAACTTCCTTGAAAGCGTCATTGTCGAATTGGAGGGAGCAGGGAATAAGAGGTGTCTGGATAAAATTGCCCATCAGCCTTGCCAACCTTATTCAACCAGTAGTAGAGGAAGGATTCTGGTACCATCACGCAGAGGAAACTTACTTAATGCTTGCATACTGGCTTCCAAATACGACTAATACATTACCTGTAAATGCTACTCACCGTGTGAGGGTTGGAGCTTTTGTAATGAATGACAAAAGAGAGGTATTGGCTGTCCAAGAAAAGTGCGGTGTACTACGAGGACTAGGTGTATGGAAATTTCCAACTGGAGTTGTTGAACCAGGGGAAGATATAAACATTGGAGCTATAAGAGAAGTAAAAGAAGAGACAGGGATTGATACAGAATTTGTTGAAGTGCTTGCCTTCAGGCAGAGCCACAAAGCTTTTTGTGATAAATCGGAACTATTTTTTGTGTGCATCTTACGGCCGCTTTCCTTTGGCATTACTAAGCAAGAATCAGAAATTGAGGCAGCTCAGTGGATGCCAGTGGAGGAATTTGCGGCGCAACCATTTGTCAAGAAACATGAAGTCGTGAAGTACATTCTTGATGTCGGTTTGGCTAATGTTGACAAGGGATATGCAGGATTTTCACCAATCCTCATAAAATCAGCATTCACAGACAAACCGTCCTTCTTCTACATGAACAGGAGGGACCTAGACAAGGCCTCAGGATCCAGTAATATGTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01002494G0310 gene.
GATATACATTTATTATTATTATTATTATTATATATATACAGCCGTGTCCCCGTGTCGCCATTTTTTAGAAAATGGCGTATCCCGTGTCCGATACGTATCGTGTCCGACACGCGTGTCCGTGTCCGTGCATCCTAGGTGATGACTGCTGAGGATGGGCAGGAAAGGTATAGCCACCACTAAATTGTCTCTATCCCATTTCTTTTGCCTATCATGAGCATCTTTTTCATCAATCCATCTTTGTTTCTTTCTCCTAGGTCTACGATCCGGCGTCCCAGCATCTGGGAATGGGACGCTCCACGTCTATCTATCCCTACCACACCTATTTCCTTCCTTGCTTATAATTTTTACAAAATCACGAGAAATAGTTCACGCGAGTTCAGATCACATTGTAATCGCAGCTCGATAAGACGCGCAATACGGAGAATGAGAATCTAAAAAAACACACTGAGATAATCCTAAATCGATCCGCAGAGAGCAAAACTATCGATCTAACGCAGCATAATTGCGTCGGATCTAAGCACACAACGACAGCTTCCCAGGCTTCGCTTTCGAACCTGTTGAGAGTTAAAACACACAGCGACAAGCCAAGCACTGGCTGACGGGCGCCAGTGCTGGATCGAGCACGCACCTCCGGCTCCGAGGAGCGCGCCGCGGAGGAGCGTAAGCCTCCGGTGGCCTGCGCGGCGGAGCCCGCCGGGAGGAGGCGTTGGCGGCGGGGCAGAGCAGGCGGGGCAAGAGAGGCGCACACGCGTCCGCGTGGGGAGCGAGAGCGAGTGGGCGGTCATCTGGTTCAGCGCATCCCCCTTCGCGTTTTATTACGGGGTGCCGCGCTACACGCTACTAGCGCGGCGGTTTACGAGCGAGCGAGACGCGAGACGGCGAAGTGGCATCGGGTGCGGCTCTAGGCGTGTGTGGTGTATGATGGTTTCGACCGCCTGCTCGTGGGGCGCGAGGGCGCGACGTCGCCCGCGCGTGGCGTGGCCTTAGCACACTCCGCACGC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01002494 Download
Protein sequence
Protein sequence
MSSSTNSTVVAESALTEKAGDVEMLPFVNDIHGGVIIEMTTPMDPQVFSTSLKASLSNWREQGIRGVWIKLPISLANLIQPVVEEGFWYHHAEETYLMLAYWLPNTTNTLPVNATHRVRVGAFVMNDKREVLAVQEKCGVLRGLGVWKFPTGVVEPGEDINIGAIREVKEETGIDTEFVEVLAFRQSHKAFCDKSELFFVCILRPLSFGITKQESEIEAAQWMPVEEFAAQPFVKKHEVVKYILDVGLANVDKGYAGFSPILIKSAFTDKPSFFYMNRRDLDKASGSSNM
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above