gene PH01002242G0280
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01002242:192557 - 195908(- stand)   Name
Alternate name Locus tag PH01002242G0280
Length of gene 3352  bp Length of CDS 1314  bp
Product information
Feature type
CDS
Product name
eukaryotic peptide chain release factor subunit 1-1
Alternate name
ETF1, ERF1
Molecular weight
(predicted)
49026.4727200001  kDa
Isoeletric point
(predicted)
5.01189041137695
Length
437  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_127250 4
Please click OG5_127250 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT1G12920.1
eukaryotic release factor 1-2
Encodes a eukaryotic release factor one homolog.
eukaryotic release factor 1-2 (ERF1-2); FUNCTIONS IN: translation release factor activity; INVOLVED IN: translational termination; LOCATED IN: translation release factor complex, plasma membrane; EXPRESSED IN: leaf; CONTAINS InterPro DOMAIN/s: eRF1 domain
0
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os05g31020.1 eukaryotic peptide chain release factor subunit 1-1, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
  1. Domain
1 50 100 150 200 250 300 350 400 437
Detailed signature matches
    1. PTHR10113 (PEPTIDE ...)
    1. PF03463 (eRF1_1)
    1. SSF55481 (N-termina...)
    1. PF03464 (eRF1_2)
    1. PF03465 (eRF1_3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF53137 (Translati...)
  2. SSF55315 (L30e-like)
GO term prediction

Biological Process

GO:0006415 translational termination

Molecular Function

GO:0016149 translation release factor activity, codon specific

Cellular Component

GO:0005737 cytoplasm

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
KEGG orthology Functional Subsystem Pathway
Genetic Information Processing Translation mRNA surveillance pathway  
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
ID for KEGG orthology Reaction description EC number
K03265 peptide chain release factor subunit 1
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 217574 7 140 1.79E-43 pfam03463 eRF1_1 cl04089 -
superfamily 217574 7 140 1.79E-43 cl04089 eRF1_1 superfamily - -
specific 217575 144 278 2.79E-41 pfam03464 eRF1_2 cl04090 -
superfamily 217575 144 278 2.79E-41 cl04090 eRF1_2 superfamily - -
specific 146221 281 417 8.36E-33 pfam03465 eRF1_3 cl04091 -
superfamily 146221 281 417 8.36E-33 cl04091 eRF1_3 superfamily - -
multi-dom 224420 5 420 1.04E-154 COG1503 eRF1 - -
multi-dom 234307 12 417 6.51E-137 TIGR03676 aRF1/eRF1 - -
multi-dom 235198 1 417 2.15E-112 PRK04011 PRK04011 - -
multi-dom 224454 95 417 4.96E-13 COG1537 PelA - N
multi-dom 129217 95 334 4.25E-09 TIGR00111 pelota - N
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01002242G0280 gene.
TTAACTAGCCCCTATCATAATGTCATGCACTTGCTACTTGCTAATTAGTAGTTACCACTACTTGCTTAACTAGTTAACCACCCTCTGTTGTCGTGTGATGTATTTAAATTTGCTTGTTAAACTACTAATCTAGTTGCATTTTGGACATGTAGTATGGTTGATTGATCTTTATTTGTGCGACATATATTGTTTCTGTTTTCGCGCAATATCCGAATAAGTATTCGTGACCGAGACACTCCATATTCGGTTCGACATGTATTCACTGCGTATTCGTAACCGAGACTATCCGCATTCGTATTCATATCCGGTATTTTTCATGTCTGATTCCGAATTCGAGAAAAAAATATATGAAAATTGGTATGGGATGAGCGATATCCGTCTATATCCGCTTTGTTTGCACCCCTACTCTCGTTGCTATAACTTTTTACTCGTTTATCCAAATTTAATGATCTTACTCTCTAAAAATATAAGAAAATTAGCTACAACTTCAGTGACATAGAAACGTCATGAATCTAGACGGAGATACACCAAAATCCTCTCATAAGGTTCTACAGTACTACTTCCCGAATTATGGCATCCCAAAACGTTTCCCTCTACTAGCTGGTAGCATCAACATAAGGAGACGGTGCTGGGTTGAAGCAGCAGGGACATCAAGCGCAGTGGCTTGCAGCAGGAGCGCATGGGCTAGGGTTTTGGGCCCCCCTCCCGTCCAAGTAACTCCGGACTCGGTTGGAGACCCAAACCGGGCCCACGTCCAGCTCCTTTTCCCCTCTAAATCGTGAAATCTAACACTTTTAGTCCTATTCCCTTTTAATCCGCTTTCTAATATACTGTAAACAACATCATGCAATATCAGATTCATAGCAACACACTGACACACCACCGGCATGTAAATAGCTATGTAAATAGTACTAAGATAGGTCCACTGAGAAATTATCACAGACGTCTTAACCATACAGGCAACTCACACTTGGCACACAACTCAACTTATCACGGAGAAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGAGAGGGGCATGAAACTGACAAGAACATTGAGATATGGAAGGTCAAGAAGTTAATCAAGGCGCTCGATGCTGCCAGGGGCAATGGTACGAGCATGATTTCTCTCATCATGCCGCCTCGTGATCAAATCTCTCGAGTCACTAAGATGTTGGGTGATGAGTATGGAACTGCCTCTAACATCAAGAGCAGAGTCAACCGGCAGTCTGTGTTGGCTGCCATAACCTCTGCTCAACAGAGGTTGAAGCTGTACAGTCGGGTTCCCCCAAATGGATTGGTGCTCTATACTGGGACCATTGTCACTGATGATGGCAAAGAAAAGAAGGTCACCTTTGACTTTGAGCCATTCAGGCCTATAAATGCTTCATTGTATCTCTGTGACAACAAGTTCCACACCGAGGCGCTGAATGAGCTTCTGGAGTCTGATGACAAGTTCGGTTTTATAATCATGGATGGCAATGGAACACTCTATGGCACATTGAGTGGCAGCAGTAGGGATGTTCTTTACAGGTTCAGTGTTGATCTCCCGAAGAAGCATGGACGGGGAGGGCAGTCTGCGCTTCGCTTTGCCCGCCTGCGCATGGAGAGGCGACACAACTACTTGCGTAAAGCAGCTGAGCTCGCGACACAATTCTTCATCAATCCTGCCACTAACCAGCCAAACGTTGTTGGGCTCATCCTAGCTGGTTCTGCTGACTTCAAGACTGAGCTGGGAAAATCTGAGATGTTTGATCCACGCCTGCAAGCCAAGGTAATCAAGACTATTGATGTGTCGTATGGAGGGGAGAGCGGCTTCAACCAAGCCATCGAGATGTCTGCCGAGGTCCTATCTGATGTGAAGTTTGTTCAAGAAAAGAAGCTGATTGGGAAGTACTTTGAGGAGATAAGCCAAGACACTGGGAAGTATGTCCTCGGTGTGCAGGACACCATGACAGCCCTCGAAATGGGTGCTGTAGATACGCTGATCGTGTGGGAAAACCTCGATGTCAGGCGATATGAGCTGAAGAATTCCGCCACAGGAGAGACAGTGATAAAGTACCTCAACAGTAATCAGGAGGCAGATCAGAGCAACTTCATAGACGAGGCACCATCCGGGGAACTGGATGTCATTGACAGGATGCTGCTGCTGGAGTGGTTTGCTGAGAATTACCAGCAGTACGGTTGCACGCTGGAGTTTGTCACAAACAAGTCACAGGAAGGATCGCAGTTCTGCCGGGGCTTTGGCGGTATCGGCGGGATCCTCCGCTACCCCGCGGATGTCACTGCCTACGACGACGACATGTTGGACGAGGAGGACCATGAAGACTTCGAATAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01002242G0280 gene.
GGCCTCATCGAGATCGGACGGCCCAGTTTCATTTATGGAAAAAAAAATCTATTCTACTCATCCGAAGTACGAATGTCCACTTAACCCATAAACTTTAAATTGTCTTATTTAAGACTATACTTCTAATACAGCATCGTTTCACCTCTTATGGGGTCAATTTTGAGGGTGGTTTTGACTTTGACGTTGTGCCGTCATATTACCCAATTTTGCTAATACGCCGCGACATCACCTTCTCTCTCTTCTTCCTCTTTTGTCTTTCTTTCTTTGCCTCCTTTCTACTCCCTCTGGACATCAAAGGTTTGCTGATTCAAATCCGAACAGGGCGGATGTATAGTGTTCTACCCGGTTGCATAGGACACCAAATCAAAAAATAATTTTTCTTTAGATATAATTATGTATATATAGTATAAACATCTCTAGCCCAAGATAACAGGATATTCCAAGCCACAGCCCAACCTGTTATAGATATGTATAAGGAGTGAGGACCCCAGTTATTTTCGGTTTGAATCCGCCACCGAATCCGAAAGACCTTTGGTAATATGATTACAGCGACCTAGCAAGGTTCAAATTCAGTCTATCAATGAGCAAAATAGTAAAAGAAAAACAATTGGAAAAGTCGTGGTAGTATGGCCCGGTCTATTGGGGGTTCACATCACGTGTGCCCTGGTGAGAAAACGTGTGACTGACCTACGCAAAAACACGCTAGCAGCACAAATTATCATCAAACCAAAGCCATTTTTGTATCGACATGAGTAGTGCGCGTAGCAGTGCCAGTGAGTATCGAACATTTCCTTTTGGCTTCTTATTCTATTCACCAACCAGTTTAACCGAGCCAAGTGTCTCCTTCCGGCACCGCACTATAGTAGCGGCGGCACCTGGCACGGCACCGTGGTAGAACACACAACACCTGGCGCGGCGGAAGACCGGTCGCTCCACCTTGCTTTGACCCACACCAAACGCAACCGAACGCGCCCACGGTATATATTTATTTGTACGCAACG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01002242 Download
Protein sequence
Protein sequence
MGEGHETDKNIEIWKVKKLIKALDAARGNGTSMISLIMPPRDQISRVTKMLGDEYGTASNIKSRVNRQSVLAAITSAQQRLKLYSRVPPNGLVLYTGTIVTDDGKEKKVTFDFEPFRPINASLYLCDNKFHTEALNELLESDDKFGFIIMDGNGTLYGTLSGSSRDVLYRFSVDLPKKHGRGGQSALRFARLRMERRHNYLRKAAELATQFFINPATNQPNVVGLILAGSADFKTELGKSEMFDPRLQAKVIKTIDVSYGGESGFNQAIEMSAEVLSDVKFVQEKKLIGKYFEEISQDTGKYVLGVQDTMTALEMGAVDTLIVWENLDVRRYELKNSATGETVIKYLNSNQEADQSNFIDEAPSGELDVIDRMLLLEWFAENYQQYGCTLEFVTNKSQEGSQFCRGFGGIGGILRYPADVTAYDDDMLDEEDHEDFE
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above