gene PH01002069G0200
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01002069:163610 - 167724(+ stand)   Name
Alternate name Locus tag PH01002069G0200
Length of gene 4115  bp Length of CDS 762  bp
Product information
Feature type
CDS
Product name
MYB family transcription factor
Alternate name
Molecular weight
(predicted)
28306.5950199999  kDa
Isoeletric point
(predicted)
8.35060501098632
Length
253  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
(0 result)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os06g45890.1 MYB family transcription factor, putative, expressed 1E-112
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 253
Detailed signature matches
    1. SSF46689 (Homeodoma...)
    1. PF00249 (Myb_DNA-bi...)
    1. PS51294 (HTH_MYB)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31314 (FAMILY N...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding
GO:0003682 chromatin binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 130620 18 70 1.07E-21 TIGR01557 myb_SHAQKYF cl17250 -
superfamily 247804 18 70 1.07E-21 cl17250 SANT superfamily - -
non-specific 215818 19 70 4.74E-06 pfam00249 Myb_DNA-binding cl17250 -
multi-dom 178707 19 70 1.50E-09 PLN03162 PLN03162 - NC
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01002069G0200 gene.
TCCAGGAAATAATTTCAAAGACCGTGTCCTTGTCCCTATCCATGAGTTGAAGTGAACCGATCGAGGAAGCATCCATGAATTTGGATTGGTTGGGATTGGACGTGACATCGATGCAAGCTAGCCTTTTTCTCTCCTTTTTTTTTTGTCTACCCTCTAGACAAGAATGTACTGTCCAAAGTCCACAATTCATTTCCCGTACGTAGAGATCGAATACTTGGCTTCACTCGTTCTTTCATTTTCTTCGTGATGTCACTGGTGTAATGTCGATAGGTCATTGCAAACTACTACCTTGACTTCATAGCATTTTATCCTGCAAGATTGCAACACCAGCCACAGAACTCTTCGTCAGGCAAACAGCCATGTATGTCTCCCGTGTATAAATCAAGCTAGGTAGGCACAAATTGATCTCTGGCTATTTTATGGCCTGTGTTTTCCCGTGAAAATTCTGTGCCTAGCGCGCGCTCTCTCTCTCTCNNNNNNNNNNCTCTCTCTCTCTCCAATACAAGACAATAAAGTTAGCAACTTGAACTCTATCACTCACAAGTAGTTGAAATCGAATTTCTGAGGGATATGTCCATTTCTGTATGCTTTCATACATGCTAGCTTTTGACAATGGAAGCATGCAAGAGTACACGGTGGACGGTGCTACTTGTTGGGCATGCTTATTCGTTTCCCATTTTCTTGGGGAAATCCAGGGAGAAGACTTTAATTGACTTTAAACATTTCAGTTTGTTGTCTATTTCTGAATTAAATATATACAGTCTGTACGCACATATCAATAAGCGGAAAACGAACGTACGTAGACATTACTACTAGTTTTCTTCAGTAAGTTTGTCAAGCTTGCCACATAGACAGAGATGGCTAATAAATGTTGCGTTGAACAAATTAAATTAACCAACGAAATCGACAGTATTTTTTTTGTCAAACAGGAGAACTATTCATCACCGGTCGTTTTAGGTAGACCCAGACAAATCAATTAATAATGTGAGCTCGTTCGATCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGAGAGGGTTTGAGAGGAGAGGAGTCCGGCTGTACAACCGATCCGACGTGCCGCGGATGCGGTGGACGGAGGAGCTGCACCGGCAGTTCGTCGAGGCCGTCGAGTGCCTCGGCGGTCAGGATGAAGCAACACCGAAGCGAATTCTTCAGTTGATGGGCGTGAAGGGAGTTAGCTTATCTCATATCAAGAGTCATCTTCAGATGTACAGATCAAGCTCTAGCAACAACAGTAACCATCCGGCCAGCCTCCAGAATTTGATGACAACCACTGCGAGCAACATTAACAAACGTGTGTTTATGAACCGTGAAGATCACTGCGTTTATGCGACGTCACAGGATGGAAACACGGCAGCTTCAGACAGGAACGCTTACACCATGCTCCGCTGCAGCCACTCATCACCATATCATCAATTACCATCAACAGAAGAAGTTATTAGAAGCTGGGAACAAAGTAGAGGGCGTCTCCCATGGAAGTCCAATTTGCTTACAACAGAAAAGGCAACTAGGCCAAGTCACACTACTAACAAGAAGCCTCGGAAGCAAACGGACTGCGACCTGACGCTGTCGATCGGCATGTGGGAGGAAGCGAGCAGCGACGCCGACGGCTCGAGCACGATCAGCGAGGAGCTCGCCGCGCCGTCGAGGGACGAAGGGTTCGGCTCTCCGGCAGCAGGCGATCACCACGCCGCTACTGTGAAGAAGGAGAGCAATCTACCGGCTCTAAACCTGGACCTGACCATTTCATCTTCTTGGCTCACCTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01002069G0200 gene.
ATAAAAATCGTCTGTGATACGTAGGATATCACAGACGGTTTGTAAATACAAGCTGTCTATGATATGTCTCTAATCCCACCGGTGATACTAGCCCTTCACACCCTTCACAGACGGTTTGTAAATAGAACCGTCTGTGATACTAGCTCTTCACAGACAGTTTGTCAATGGAACCGTCTGTGATACTAGCCCTTCACAGATGGTTTCAACAAAAAACCGTCTGTGATACTTCTTTATACCTATCTTTTTTTTTCGGTTAGCCTCAGGAATTGCTAGCCATGCCCTCTGAAAACAAGCATGCAGAAAACAGATACATCACAGATAATCAATTGTTGACAACTCGAAATGATCATTTACAACTCAAAATCAATTACAAAAGAATTTGTTCAAGTATTGTCGCTATAGTTACAATTGAATTACAATTGAATCAATTGTTTGAAGGTGGTTGAGAGGTGTTGACGGAGTGAAACTCTCCGTCAGCGTTAATGATATCTGTCTTGATGAAGGCGCAGAGCTTTCCTCGAACGTCCGCGATCTCTTTCACAACGAGTGCATCTAAATCTATGTTCAAGCCCTGTCGCTACCAAGAGTAAAGTAGTAACACTACTACAGAAAAGGCCTTCACAGACGGTTCAAAAACACCATCACAGACGGTTTCGTGAGCTGTCTGAGTCTATGGGTCAGTAATAACATGAGGTCATCACAAACGGTTTTCGAACCGTCTGTGATGCATACTTTCACAGACGGTTATTAACTCAGAACCGTCTGTGATATACGACTATCACAGACGGTTTGTATCTAGAACCGTCTGTGATAATTATCTATCACAGACGGTTCTAACACCAAACCGTCTGTGATAACTATCTATCACAGACGGTTCTAAACACGAACCGTCTGTGATAACTAGCTATCACAGACGGTTCGTGTTTAGAACCGTTTGTGATATATAAATAAAACCTCCAAGCAATGGCTGCTTGTGCCTTTAAAACCGGCTTCACACACAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01002069 Download
Protein sequence
Protein sequence
MRGFERRGVRLYNRSDVPRMRWTEELHRQFVEAVECLGGQDEATPKRILQLMGVKGVSLSHIKSHLQMYRSSSSNNSNHPASLQNLMTTTASNINKRVFMNREDHCVYATSQDGNTAASDRNAYTMLRCSHSSPYHQLPSTEEVIRSWEQSRGRLPWKSNLLTTEKATRPSHTTNKKPRKQTDCDLTLSIGMWEEASSDADGSSTISEELAAPSRDEGFGSPAAGDHHAATVKKESNLPALNLDLTISSSWLT
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above