gene PH01001994G0160
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001994:130775 - 138362(- stand)   Name
Alternate name Locus tag PH01001994G0160
Length of gene 7588  bp Length of CDS 1182  bp
Product information
Feature type
CDS
Product name
la domain containing protein
Alternate name
Molecular weight
(predicted)
43080.10162  kDa
Isoeletric point
(predicted)
8.66633987426757
Length
393  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_144083 3
Please click OG5_144083 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os11g14300.1 la domain containing protein, expressed 4E-133
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 393
Detailed signature matches
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR22792 (LUPUS LA...)
  2. SSF46785 ("Winged h...)
  3. SSF54928 (RNA-bindi...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0000166 nucleotide binding
GO:0003676 nucleic acid binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 240734 124 216 8.04E-39 cd12288 RRM_La_like_plant cl17169 -
superfamily 247723 124 216 8.04E-39 cl17169 RRM_SF superfamily - -
non-specific 153402 67 109 3.15E-15 cd08033 LARP_6 cl02755 N
superfamily 207717 67 109 3.15E-15 cl02755 LAM superfamily - N
non-specific 128955 67 109 2.36E-12 smart00715 LA cl02755 N
non-specific 153396 54 109 2.31E-08 cd07323 LAM cl02755 N
non-specific 240735 124 217 3.26E-08 cd12289 RRM_LARP6 cl17169 -
non-specific 153398 67 109 1.54E-07 cd08029 LA_like_fungal cl02755 N
non-specific 240668 130 214 1.96E-07 cd00590 RRM_SF cl17169 -
non-specific 215696 130 202 8.64E-07 pfam00076 RRM_1 cl17169 -
non-specific 240808 130 202 1.08E-06 cd12362 RRM3_CELF1-6 cl17169 -
non-specific 214636 124 202 3.78E-06 smart00360 RRM cl17169 -
non-specific 240800 130 202 1.89E-05 cd12354 RRM3_TIA1_like cl17169 C
non-specific 240824 130 204 1.93E-05 cd12378 RRM1_I_PABPs cl17169 C
non-specific 203243 67 95 2.54E-05 pfam05383 La cl02755 N
non-specific 153399 67 109 6.67E-05 cd08030 LA_like_plant cl02755 N
non-specific 240861 124 220 7.41E-05 cd12415 RRM3_RBM28_like cl17169 -
non-specific 240719 126 202 9.60E-05 cd12273 RRM1_NEFsp cl17169 -
non-specific 206064 140 215 0.00010625 pfam13893 RRM_5 cl17169 -
non-specific 240844 130 213 0.000226395 cd12398 RRM_CSTF2_RNA15_like cl17169 -
non-specific 222631 126 203 0.000437065 pfam14259 RRM_6 cl17169 -
non-specific 240687 124 202 0.000500859 cd12241 RRM_SF3B14 cl17169 C
non-specific 240764 140 202 0.000806652 cd12318 RRM5_RBM19_like cl17169 -
non-specific 240845 130 204 0.00110219 cd12399 RRM_HP0827_like cl17169 -
non-specific 240801 138 203 0.00112407 cd12355 RRM_RBM18 cl17169 -
non-specific 240724 140 202 0.00132997 cd12278 RRM_eIF3B cl17169 N
non-specific 153401 67 109 0.00161082 cd08032 LARP_7 cl02755 N
non-specific 153400 67 108 0.00163573 cd08031 LARP_4_5_like cl02755 N
non-specific 240825 130 202 0.00194423 cd12379 RRM2_I_PABPs cl17169 -
non-specific 241015 124 203 0.00207278 cd12571 RRM6_RBM19 cl17169 -
non-specific 240809 138 213 0.00217747 cd12363 RRM_TRA2 cl17169 -
non-specific 240973 122 215 0.00248133 cd12529 RRM2_MEI2_like cl17169 -
non-specific 240836 129 213 0.00256007 cd12390 RRM3_RAVER cl17169 -
non-specific 241058 164 213 0.00276073 cd12614 RRM1_PUB1 cl17169 N
non-specific 240838 130 202 0.00303146 cd12392 RRM2_SART3 cl17169 C
non-specific 240695 130 220 0.00659641 cd12249 RRM1_hnRNPR_like cl17169 -
non-specific 240819 184 215 0.00682549 cd12373 RRM_SRSF3_like cl17169 N
non-specific 240751 179 203 0.00690069 cd12305 RRM_NELFE cl17169 NC
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic RNA binding site F75,K76,K77 10 3 153402
 
DNA sequence
Upstream 1000 bp region from PH01001994G0160 gene.
GGCCACGGCGACATGCGCGGCCGCGAGCGCTAGCACCAGCAGGAGTCAGGAGATGCACGAAGAGGAGCGCGGGCGGGAGGGCGCGGGCGAGGATGACAACAAGCGGCGGCGCGGAGATGAGCACAAGCTTCCTTGGCCAGCGCATCAACCCCTCTGGCTACCGCAGTACCGCCACCGTCGCCGCCCCGGCCATGCACGCTCGCCACGCCCAACGAGCTCGCAGTTGCTCGACATCATCGCGGCGGTGGCCGCATCGACGACGGCGTTATTTCGCTTGCGTGTCCTCGGCAAGCTACCCGCACATGCGGCAAGCCGGCGACCATGACATCCTCGAGACCTCGACTCGCTAGCTGCTTATTCGCTGTTCGTGTGCTGTTCGCGTTCCAAGTGGCAAGTGCCGAAAAGATGAGTTTGCTCTCACGTTAATCAATACTGAGATTGAATAGTCTTGTGACCTCCAAAAAATTACGCCGCCGTTCTTGTGCACTAGCGGCTGCGGTACCTTCTTCTCCCCACAGCACCAGCTGCAGCGGTGGCCAATTAATGCTTGGTGTGGCCGGCGACGCCCCATGGCCGGCGAGACGAGCCTGATTTGGCGGCGGGCTTGAGCAGGGGAGAGGGGGAGAGATGGAGAGGAGGACGTGGACATTGACGTGGATGTGGACTTAGATGCCATGTTGGAGAAATAGGTACACCTAGATGCGGAAGGAAATCCTCTAGGACGGGGCTTCCGTGAGGCCCTGAGTCCCGAGCCGCTCGATCAAAGGGAGTGAGATGGATGGTCAGATGAAGGGGTCTTACGGAGAGACCCTGTTCTACCCTATTTTTTTCCCCCTAGATGTCATATTAGTGAAACCAGAGTGGTTTTAGACGAAAAGAGTGATTTGAACTGATTTTGATAGTGGAAGGGTGTTAAATGTCCGATTTTATAATTGAAGCTTGATTTATGGACTTGAGCGAGAGTTAAAGTGGGGATAAATTGAACTTATTCTGGTAATAAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCCATGGACCCTTCACTGTTGCACAGCGCTGGCATCGACCTAGCCATTGGGCCTCCTCCCATTAGGTTTGCATCCACGATTAGAATGCCATCACGCTGTCCCTCTGTTTTGGGTTCACCACCTCCCAGCGAATCAGACTACAAATCACCACGAATCAGATCGTTGCCGAACCCTGACAATATTTGCCACGAATCCGTACCAATACCAGTTGTTGCTGGATTTAAGAAAATTAAGGCTTTGGTACAAAGTAATTCAATGCTTGCTTCAGCTCTTCGGACTTCATCAAAGCTAGTAGTCAGTGAAGATGGAAAAAGAATAAAACGTGAGCAGCCATTTACAGAATCAGATTTAGAAGAACTCCAGGCCCGAATTGTTGTTGCCGAAAATCTTCCAGATGATCATTGTTACCAAAATCTTATGAAGCTCTTTTCAGCTGTTGGCAGTGTAAGGACAATCCGGACATGCTATCCTCAGACCCCAAATGGCACTGGTCCAGTTACTAATAGATCTGCCAAGTTAGATATGCTTTTCGCCAACAAGTTGCATGCTTTTGTTGAGTATGATACTATTGAGGATGCTGAGAAAGCGATTGTGGAACTTAATGATGAGAGGAACTGGAGAAGTGGGCTTAGAGTTCGATTGTTGAATACTTGCATGACAAAGGGAGGTAAAGGGAAAAAGGGTGGGCATGAAGCTGATGGACACGGAGAGGAGGATGATGTCTCCACTTCTAACCAACCAAATGAGAAATATCCAGAAGAAACACCTCAACTGTCAGATGCACTGGGAGAGCACGTGCCTGAGGAGAGCATGGGAGATATGGGCCGAGGGTGTGGCAGAAGCCGTGGACGTGGAGGCAGAGGCCGAGGGCGTGGTTACCACCATCATAACAACAATCAATACCACCACAGCAACCACCAGCAACACCATCACCAAAACAGCAACCACCACGGTAACAACCGGAGTGGTGCCCATCCAGTTGGAACTCCGCCATCCAGCCACCCAGTCAAGACTGAGCAGCAGCAACAGCAACATCAGCAGCCGCAGCAGACACAGCCACTCGCAGGAGCTAACAAACAGCCTCCAGGACCACGCATGCCCGATGGCACACGTGGATTCACCATGGGCAGAGGGAAGCCACAAACATCGACACCCAGTGTACCCACCAGTGAACCTTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001994G0160 gene.
GCATATATTCACTATGGAAGCCCATTTTAATTCTCAGCATCAGGTCAAAGTACCAAGACCTTAAACATGATGTTATTTCTACTTTCTATTGATGGAACAGAAAACTATAAATGCTAAAAAAACGATGACAGCTTTATTTCAAGAAAGCATCATACAACAGTAACAGCAGGAATCGATATGGTAAATAGTTTCAGATGCAAGCATACAACTCACCATATCCTTCAGGGTCCTTAGTAATAAACCTCATCAAATGTTCAGTAGTGGCCAGGTTTATATCACTGAAATAATACTCCACCTACAAGGTTTATATTTATGAAATGANNNNNNNNNNTGTTAGTTCGGATTTCACAATTAATAAAAGTTTCGTCCTTTAATCGAATCTTAGAATAGATTGAACATTATCCTGATTAACACACATCCAAGATCCAAGAGAAAACGCACCTACAAAACATGAGCAACATAAGTTACAGTAAAAAAATCATACAGGAAATGCTTTGTACCATCTAGGAAAGTAACTGAACAGTAGCATGCATATATTCACTATGGAAGCCCATTTTAATTCTCAGCATCAGGTCAAAGTACCAAGACCTTAAACATGATGTTATTTCTACTTTCTATTGATGGAACAGAAAACTATAAATGCTAAAAAAACGATGACAGCTTTATTTCAAGAAAGCATCATACAACAGTAACAGCAGGAATCGATATGGTAAATAGTTTCAGATGCAAGCATACAACTCACCATATCCTTCAGGGTCCTTAGTAATAAACCTCATCAAATGTTCAGTAGTGGCCAGGTTTATATCACTGAAATAATACTCCACCTACAAGGTTTATATTTATGAAATGAAAAAAATTAGAAAAAAAATGCTCTTTACAGCACACAAACTAAAATACAACAGCATTCCCTTTGCCAGGGTTTTCTAGACCACTACCAGCCGCAAATAGATGTCAGAACAAATTAGTTGAAAATTAACACTCTTTAAACTAAAACGAAGCAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001994 Download
Protein sequence
Protein sequence
MAMDPSLLHSAGIDLAIGPPPIRFASTIRMPSRCPSVLGSPPPSESDYKSPRIRSLPNPDNICHESVPIPVVAGFKKIKALVQSNSMLASALRTSSKLVVSEDGKRIKREQPFTESDLEELQARIVVAENLPDDHCYQNLMKLFSAVGSVRTIRTCYPQTPNGTGPVTNRSAKLDMLFANKLHAFVEYDTIEDAEKAIVELNDERNWRSGLRVRLLNTCMTKGGKGKKGGHEADGHGEEDDVSTSNQPNEKYPEETPQLSDALGEHVPEESMGDMGRGCGRSRGRGGRGRGRGYHHHNNNQYHHSNHQQHHHQNSNHHGNNRSGAHPVGTPPSSHPVKTEQQQQQHQQPQQTQPLAGANKQPPGPRMPDGTRGFTMGRGKPQTSTPSVPTSEP
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above