gene PH01001952G0230
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001952:188728 - 190513(- stand)   Name
Alternate name Locus tag PH01001952G0230
Length of gene 1786  bp Length of CDS 237  bp
Product information
Feature type
CDS
Product name
OsMADS1 - MADS-box family gene with MIKCc type-box
Alternate name
Molecular weight
(predicted)
8941.50361999999  kDa
Isoeletric point
(predicted)
10.6377601623535
Length
78  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_205220 4
Please click OG5_205220 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G15800.1
K-box region and MADS-box transcription factor family protein
Encodes a MADS box transcription factor involved flower and ovule development. Functionally redundant with SEP2 and SEP3.
SEPALLATA1 (SEP1); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: flower development, ovule development; LOCATED IN: nucleus; EXPRESSED IN: 12 plant structures; EXPRESSED DURING: 6 growth stages; CONTA
1E-32
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 10 20 30 40 50 60 70 78
Detailed signature matches
    1. PF00319 (SRF-TF)
    2. SM00432 (MADS)
    3. SSF55455 (SRF-like)
    4. PS50066 (MADS_BOX_2)
    5. PS00350 (MADS_BOX_1)
    6. PR00404 (MADSDOMAIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR11945 (MADS BOX...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding
GO:0046983 protein dimerization activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238165 2 61 2.24E-37 cd00265 MADS_MEF2_like cl00109 C
superfamily 241616 2 61 2.24E-37 cl00109 MADS superfamily - C
non-specific 197721 2 60 2.26E-31 smart00432 MADS cl00109 -
non-specific 238067 2 60 7.24E-30 cd00120 MADS cl00109 -
non-specific 238166 2 61 9.57E-26 cd00266 MADS_SRF_like cl00109 C
non-specific 109379 9 59 6.30E-23 pfam00319 SRF-TF cl00109 -
multi-dom 227400 1 65 7.45E-15 COG5068 ARG80 - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site G2,R3,G4,L6,L8,N13,I15,V19,T20,K23,R24,N26,G27,K30,K31,Y33,E34,L38 18 18 238165
specific putative phosphorylation site S59 1 1 238165
specific dimerization interface F21,L28,L29,A32,Y33,L35,S36,C39,A44,I46,F48,L54,E56 19 13 238165
 
DNA sequence
Upstream 1000 bp region from PH01001952G0230 gene.
CATTAAAGACAGCTCAGACAATGGGTTATGGTGATACAGTCGGCAATAGAATTGTAGACAACACATAATTTTTTAATATTTTTCTTGGTTCAGGTGATATAGTCGACTACAGAATTACAGACAGCATATTTATCTCTTTTTATTCTTTTTCATTTACATTAACTTAAATCTGACGTAACAAAAGTCATAAACAGCTGACTTAAACCATTGTACATGACGTAAATAATTCCCAACGTACTTAATTCCCAACCGAGGGAGTATATTGCATGCAATGCTTAGCTGATTGATTGATATGACGTGTGAAGGAAAAGTTCACGTGATATCTGACTTTGCAGGATGTAAATGACGGTTCGGAAGTCCGAGCGCCATCGATTAGTAGTGCTACACGGGACTCGACGAGGATAAGAAAACATGGGGAGAGATGCTATCTTCGATGGAACAGTAACTAATGGAACAGTAGCGTGCAGATCTCAACACGTTGTAGAGGCTTTATAACACCACTACACCAAATTATAATATTGACGATTCCATGTCCCTCCCCTCTGGTCTCGTTTCGACACTACTATCTTTGGATGAGTCGACAAAAAAGACGATCGATCTAGTGACCATGAATGGGAAAAGAAACAGAAGGAAGAGATCTTAGGGGTAGCTGGAAGGCCAGTGAAACAGAAATGCTAGAAATAGAAGAAAGAGGCAGCGAGTAGATGGATTGCTTCTTTATTCTTGCCCATTATAGCAAGAGATCCAGTTAATAATCGAATCTTTCTTTTGAGGTATATAGGGCTACTGATCGAGCTCAAGAAATCTTCCTCGGGACGTGCAAGAACACAAGGCCTATTGTGTCGGGTTTAATTGCCCGAATTGGGATCGAGAAAATAAGAAACAAAAAAAATTAATTTGAACAAATAATTAAGAAGGCAATCGTCACTTCTCTGAGAGAAAAAGAGGTGTCTTCATCGTGTTTTAATCGATTGGAAGCAAGATAATAGAAAAGATCGAGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGTCGCGGGAAGTTGGAGCTGAAACGGATCGAGAACAAGATAAGCCGGCAAGTGACGTTCGCCAAGCGGCGGAACGGGCTGCTCAAGAAGGCGTACGAGCTCTCTCTGCTGTGCGACGCCGAGGTCGCGCTCATCATCTTCTCCGGCCGCGGCCGCCTCTTTGAGTTCTCAAGCTCGTCATGGTTTCCCCTCTTTGCTTTCGCCTCGATTAATTGGAGCCGGCCGGTCTCATGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001952G0230 gene.
GAGTGCAAATCCTGCACTCCTCTCATTTATAGTGGAGACTAGGTCTAGAGAAAAATCTTATCGGGCAGCCGTTAAGCCCACACGCAAACGGGTTTACACCCACACACGCTTCTCAAAGCGGATGACAAATCGGGTCTCCTGAATCCATCTCTTCATTATCTCCGTTTCTCTTGACCTAAACCGTCTCTCCTTGCACTGTGGTTTCTCTAAGGTCACCAACACGATATTTTGGCGAAGATACCAAAATACCCCTTTTCAATTATTCTCCAAAGGCTGAGTCCAATCATTATGAAGCAATCCCACGCTTTGCCACGTGTAGGTTCATCAATGACTCTCTTCATATCAGCAAGTCTCTCCCATCCGGCTCCTACTGGAACCACCATGGCACTTGCACCGACCTCTAAGCCACTTGATGTAACCCGTTGCACCAAACTTCCCTTTCGGTCGTTCTTGTTCATCTCGCGCCATACTTGAGTCCAACTGCTTTACACGACATCCTCGATCGTTCTGGACCTTAGCTCTCCTAGCATAGTCCCGATCATCCTCGTCGTTGACAGTAGTTGACTCCAAGCCACTTGCACAATAATAGACCAAGAAATCGATTCCAGACACAAGTTCTTCACAACTTAACCCACGTTAGCCAAAACATGCATCATGCAACACCTATGTACAAAATCCCATGACTTTGTACAGAGGCAAAAGAAAACAAAACAAAAATAAAAATTACAAAGATGTTATAAGGACCCTAGCCATTGTGAGATTGTTGTTTGAAAGTTGTCATTCGCTCCGTACATATTCCATTTTCTTCTTAATATATAGCTTAGGAGTCTCTCCTACTATTTAAATTCAAAAAAATCCCATGACTTTGGCCTAACCCACAAGGTTCACCGCCTTCCCAGTGCAAAAACCATTTCGGTCGGTCAAACCACTTAGGACTTTTTGCCAAGTCTTAGACTACACCTTCTTTGATGTTCATAAGGGAGAAGCTGGAGTCGTAAGAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001952 Download
Protein sequence
Protein sequence
MGRGKLELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEFSSSSWFPLFAFASINWSRPVS
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above