gene PH01001648G0010
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001648:10836 - 12119(+ stand)   Name
Alternate name Locus tag PH01001648G0010
Length of gene 1284  bp Length of CDS 723  bp
Product information
Feature type
CDS
Product name
BURP domain containing protein
Alternate name
Molecular weight
(predicted)
25110.8116199999  kDa
Isoeletric point
(predicted)
7.68730545043945
Length
241  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_205261 1
Please click OG5_205261 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G25610.1
BURP domain-containing protein
responsive to dehydration 22 (RD22) mediated by ABA
RESPONSIVE TO DESSICATION 22 (RD22); FUNCTIONS IN: nutrient reservoir activity; INVOLVED IN: response to desiccation, response to salt stress, response to abscisic acid stimulus; LOCATED IN: endomembrane system; EXPRESSED IN: 21 plant structures; EXPRESSE
9E-41
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os05g12410.1 BURP domain containing protein, expressed 6E-105
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 241
Detailed signature matches
    1. SM01045 (BURP)
    2. PF03181 (BURP)
    3. PS51277 (BURP)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31236 (FAMILY N...)
  2. PTHR31236:SF0 (SUBF...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 202568 30 241 2.03E-82 pfam03181 BURP cl03923 -
superfamily 243575 30 241 2.03E-82 cl03923 BURP superfamily - -
non-specific 214992 30 239 1.09E-46 smart01045 BURP cl03923 -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01001648G0010 gene.
GTAGGCCAACCCACACCGCCACCTCACCGTCGGTCGGATCTAGTGGCCCCAGCACCACATCCTCGTCCCCCTTACCCTGACCAAGCCACTACTGAGTTTGACATCTGCAGGGCATCTTCAACGGTGGTGGCGTGACATCAATCTAGCCAGAATAGTAGGGGCGGGAGCGGCATTCGCCGGCGATGTTCACTGGATGGCAAGCAACAGCGGGATTGGAAGGATAAAAAGAAATAGAACGTTGGAGGGCATCTTCAACAGTGGTGGTCGCCGGCGATGTTCGCTAGATGCTCGACAACGTGGCATCATTGGTTGGAACGGAGGTGGCAGCTTAGTCGGAGCTCACTCGGAGGAGAAGGGGAAGGGATACAGGTCGGAGCTCTGGCTGCCGCTGAGAAAACATGGGTGAAGAGATAAAGAAGAATGTTCTTTTTTTGGAAAATTTTCTAATATTCCACTGCTTAGTTCATGGATCCAAATCTGTACTTTACACTACAGAGTAACATTTTTAAAAGAAAAAAACTTTTCAGTGGTATATTTATGAGATATCAACTTTGCAGTGACATGTATCAATTAAATCCTATTTTTTTAGAGGAACAAGAATACTATTGATGTGGAAGAGAGTAATAAATGAGTGGTTACGAGAAAAGATAGCGGTACTCATGGTAAACTGGTGGTAGTAGAGGTCCCATGCTCTCCGGTCGCACGACGGGTATCGTTATCCTATCCTCAATCATCCAACGCTCTCCGGTATCAATCAACCACGCAATGAAGTGCGTGCGATAAGATGGCATGGCCGTCCTCCGGGTGCATTGGGCCTACCTTGTTCTGTTGTATCTGCTCAGCAATCAATAACAGTATGAGGCTGGGAGGTGCACGCATGATAATATTATATTACTATTTGCTAGGGGCGTTTCACGTGGTCTCGATCGGACCGGACGCCGACGTACTTGTTTCCCTCCCACTCCCTCCGCTATAAATACCATCGCCTGCTAGCTCGTGCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCTAGGTCACACGCCGCTCTTCTGCTCTTCCTGGTCGCTGCCGTGGCAGCTTCAGCTTCGCAGGCGGACTCAGTGGGCTCGGTGTTCTTCCTGGAGAAGGACTTGCACCCGGGCTCCAAGATGACGCTCCACTTCACCCGCGCCACTGCCGGCGCCGTACGGCTCCCCCGCGGCCGCGCCGACTCCATCCCTTTCGCCTCCGCCAAGCTTCCGGAGATCCTCTCCCGCCTCTACGTCCCTGCCGGCTCCCCCACCGCGGCCGCCATGCGCTCCACCCTCGCCGAGTGCGAGGCCACGCCGCTGGCCGGCGAGGCCAAGCGCTGCTCCACCTCCTTTGAGTCCATGGCCGACTTCGCCGCCTCCAACCTCCACACCCGCGATGTCCGCGCCGTGTCGACCAAGTTCGGCAAGGAGGGGGCGACCCCGTGGCAGGCGTACACGGTGGAGGCCGTCAAGCCCCTGCACGTCTCCGGCGGCGACATGGTGGCCTGCCACGGCATGCCCTACGCGTACGCCGTGTTCGGGTGCCACACGACCACGGCCGCCGCGTACACGGTGACCCTGGCCGGCGCCGACGGGACCAGGGCCGAGGCCCTCGCGGCGTGCCACGCAGACGCTGCGCCGGGGGTCGCCGAGGCGTACAAGAAGCTCGGCCTGGCGCCGGGGAGCGTGCCGGTGTGCCACTTCCTGCCCCAGGACGACATGCTCTGGGTGCGCAAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001648G0010 gene.
AAATTTGTGTCATCTCTCCTAATGTCGTGTGGAATTGATTAATTAATACTCCCCCGACACTAAATTGAAGAGATTTCTTTTAATAATATTATTTTAAAAGAATTACAAAAAAAATCAATTCCAAATGGCGACAGGAACATATTTATTGCTGGTTGCCGTTCCAACTGTCTGTCACTAATTCCACAGGTCATCAATTGAAATGACAACAGAAACCCACAGGTTCGTGTCGTCAATTCAACCGGCGACAGGGTTCGGCTATGTATACCCTAAAATTTGGTGAAAAAGTCATTTTAATTCCAGAAAAAAGAGAACAAAGAGGAGGAGCGGGAAGAAGAGAGAGGGGGGAGAGGGGAGAAGAGACTTAGCGAAGCCCTGTCGGTTCCTAGCGGAGGAGAGAGAGATGGAGCAGCAGATCTGGTCACCCATTTTTCTAGTAAATGTTCTTGCAATTTTGTACATAAATTCGAAACCTAGTAGGTTATCAAATAAAAATAGAGATATAGAATTCAATAGATTAGATAATTTTATCTATATTGCTGTTTGATGCAATACATCATTTTTAGCTATGCATAGTTTCGTTCATCGTATAGATATTATTTTTGTTGCAGTACTTGAATGATTTAGAATAAATCCGCAAAAATACTATGAAAACTTTGTAGGTTTTCATTTTTGGACGGTAAATATTATGTTAATGTGGAAAATACTTTTGTAACTAGGAAAATAGCAAGACACCTCTAAAAATTCTATAATAAATCCAGAGTAGGTACATAGGGTAGGTAGAGCTAAATTAAAGATGGTGAAATTAATTTTTGTTTCTATTTGTATACGGTAAATATTTTATAAATATTGGAGATACTTTTTAAACAAGGAAAATAGCAAGATACCTATTAAAAATTTATATAAATTGTAGAGTGGCTAAATAGGGTATGTAGAGCTTTATCAAAATAATCCCAATTTAATTTTGGTTTCTATTTGTGCACGGTAAATATTCTATTATTTTA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001648 Download
Protein sequence
Protein sequence
MARSHAALLLFLVAAVAASASQADSVGSVFFLEKDLHPGSKMTLHFTRATAGAVRLPRGRADSIPFASAKLPEILSRLYVPAGSPTAAAMRSTLAECEATPLAGEAKRCSTSFESMADFAASNLHTRDVRAVSTKFGKEGATPWQAYTVEAVKPLHVSGGDMVACHGMPYAYAVFGCHTTTAAAYTVTLAGADGTRAEALAACHADAAPGVAEAYKKLGLAPGSVPVCHFLPQDDMLWVRN
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above