gene PH01001563G0300
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001563:247109 - 249836(+ stand)   Name
Alternate name Locus tag PH01001563G0300
Length of gene 2728  bp Length of CDS 1335  bp
Product information
Feature type
CDS
Product name
OsSigP1 - Putative Type I Signal Peptidase homologue
Alternate name
Molecular weight
(predicted)
48725.1875200001  kDa
Isoeletric point
(predicted)
8.76156234741211
Length
444  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_212841 1
Please click OG5_212841 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os02g58139.1 OsSigP1 - Putative Type I Signal Peptidase homologue; employs a putative Ser/His catalytic dyad, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Repeat
1 50 100 150 200 250 300 350 400 444
Detailed signature matches
    1. PF13812 (PPR_3)
    2. PF13041 (PPR_2)
    3. PF01535 (PPR)
    4. PS51375 (PPR)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR24015 (FAMILY N...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 213555 248 281 3.83E-08 TIGR00756 PPR cl03252 -
superfamily 214131 248 281 3.83E-08 cl03252 PPR superfamily - -
non-specific 144943 248 278 4.14E-07 pfam01535 PPR cl03252 -
specific 144943 283 313 9.61E-07 pfam01535 PPR cl03252 -
superfamily 214131 283 313 9.61E-07 cl03252 PPR superfamily - -
non-specific 213555 283 317 2.81E-06 TIGR00756 PPR cl03252 -
specific 213555 353 386 4.51E-06 TIGR00756 PPR cl03252 -
superfamily 214131 353 386 4.51E-06 cl03252 PPR superfamily - -
non-specific 205985 247 280 1.02E-05 pfam13812 PPR_3 cl03252 -
non-specific 144943 353 383 1.57E-05 pfam01535 PPR cl03252 -
specific 213555 388 421 0.00022573 TIGR00756 PPR cl03252 -
superfamily 214131 388 421 0.00022573 cl03252 PPR superfamily - -
non-specific 144943 388 417 0.000361775 pfam01535 PPR cl03252 -
non-specific 205985 283 315 0.00230328 pfam13812 PPR_3 cl03252 -
non-specific 213555 178 212 0.00364336 TIGR00756 PPR cl03252 -
superfamily 214131 178 212 0.00364336 cl03252 PPR superfamily - -
multi-dom 205222 246 294 1.41E-18 pfam13041 PPR_2 - -
multi-dom 205222 280 328 8.75E-15 pfam13041 PPR_2 - -
multi-dom 205222 351 399 1.34E-14 pfam13041 PPR_2 - -
multi-dom 205222 211 259 3.07E-11 pfam13041 PPR_2 - -
multi-dom 205222 176 224 6.28E-07 pfam13041 PPR_2 - -
multi-dom 215636 113 423 1.17E-23 PLN03218 PLN03218 - NC
multi-dom 215636 180 423 3.19E-20 PLN03218 PLN03218 - NC
multi-dom 215563 125 414 2.72E-14 PLN03081 PLN03081 - NC
multi-dom 215636 249 421 7.90E-14 PLN03218 PLN03218 - NC
multi-dom 205222 315 364 8.03E-13 pfam13041 PPR_2 - -
multi-dom 215563 167 414 1.44E-12 PLN03081 PLN03081 - C
multi-dom 205109 242 273 2.33E-12 pfam12854 PPR_1 - -
multi-dom 215561 206 416 1.26E-11 PLN03077 PLN03077 - N
multi-dom 205109 277 309 1.94E-11 pfam12854 PPR_1 - -
multi-dom 215561 125 413 2.55E-11 PLN03077 PLN03077 - C
multi-dom 215561 216 423 1.81E-10 PLN03077 PLN03077 - NC
multi-dom 215561 163 415 4.80E-10 PLN03077 PLN03077 - C
multi-dom 205109 381 414 2.28E-06 pfam12854 PPR_1 - -
multi-dom 205109 346 378 2.96E-06 pfam12854 PPR_1 - -
multi-dom 215561 251 390 7.23E-06 PLN03077 PLN03077 - C
multi-dom 215636 257 406 1.77E-05 PLN03218 PLN03218 - NC
multi-dom 215561 180 351 0.000461539 PLN03077 PLN03077 - N
multi-dom 215561 291 421 0.000498616 PLN03077 PLN03077 - C
multi-dom 205222 386 421 0.00125068 pfam13041 PPR_2 - C
multi-dom 205109 311 343 0.00291402 pfam12854 PPR_1 - -
multi-dom 215563 163 313 0.00301151 PLN03081 PLN03081 - N
multi-dom 205109 207 238 0.00626696 pfam12854 PPR_1 - -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01001563G0300 gene.
CAGCCACCTTGATCTCAGGAGACTCGCAAATTTTAAACAACTTGTCAAACAAAATTTTCAAAGGGCAGCTTCCCATCCAAATATCTGACCAAAAGGAGGTGTTACAGCCATTGCCAATTCCAAAAGACACACCCCTGTTGAAAATATGTTTCACCTTCTGCAAACTTTTCCAAAATTGTGAACTATTTGCAGGATTGGCATCTTTAAAGCACCCCTCAGGAAAATATTTGGCTTTAATAATCCTGAACCACAATTCATTGTTACCCCTGTAAATTCTCCAAATCCACTTAACAAGTAGACAAATATTCATAATTCTAGTATTAATCACCCCTAGGCCGCCATACTCTTTGGGTCTACAAATTGCCTCCCATTTCACCATATGATATTTGAATTCATCACTAGGGCCTCTCCAAAAAAAACCAGGATCTAATAGAGTCCATCCTTTTGTGACTCTCCCCACTAAACCGATAGAATTCCATTGTGTAAGTAGGTAAGCTGCTCAAACAACTGTTAACCATGACCAGCCTCCCCCTGATGATAAAAGATTATTCTTCCAATTGTCTAGTCTTTTCCCCATTTTAGCAATCACACTTTCAGCAGCTCTGTCTCCCACATGACGATCGCCAATCATAATGCCCAGATACGTGAGGGGAAGTTTGGCCAATTTACAATCAAAAACCCCAGCCACATAAGAAGCTTCCTCATCATCACAACCCATCACGAAGACTTCACTCTTGTGATAATTAATTTTTAGACCAGACATCTATTCGAAACAGTAAAGAAGAAATTTCAGATTAGTCAAATATTCCTTCTCACACTCAATCATGATTACTGTATCGTCCGCATACTGAAGGATAGGAACACCTCCAAGAATTAGATGGGAGATCACCCCTTTGATCAACCCTTTTTCCTGTGCATTCTCAATAACCACTGAGAGGGCATCGGCAGCCAAATTAAAGAGGAGTGAAGATAGGGGATCGCCCTGTCTGAGACCTCTGTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGCCGCCACCTCCCGCCGGCGTCGACCTCACCCGCGCACTCTGCGCCACCGTCATCAAATCCACCTTCCAGCCCCACCTCGCCGCCGCCCCGTCCCTCCTCGCCGCCGTCCTCCACCGCCTCTCCCCGCTCCCCTCCGCCGCTCTCGCCTTCTTCCGCTCCCTGCCGCCGCCCCACCCGCTCGACGCCTCCCTCGCCCTCCTCCGCCTCCTCGCCTCCCACCCGCGCCACCACCCCAGCGCCCGCTCCCTCCTCCGCGACCTCTCCCTCCGCCACCCGCTCTCCTCCCCGCTCCTCCTCCCCTCCCTCCTCGCGGACCCCCACATCCCGAGCTGGCTCCTCCTCGTCCTCTCCCAGTCCGCCCGCCCCCACGATGCCATACGGGTGTTCGACCACATGCGCGCGCGCGGCATCGCCCCCGATGCCCACGCCTGCACCGCGCTCCTCACCGCGCTTGCGAGGTCACGGATGACGGCCACCGCGCGCAAGGTGTTCGACGAAATGGCGCGGGCCGGGGTCGCCATGAACACGCACGTGTACAACGCCATGCTGCACGTATGCCTGAAGGCTGGGGACGGCGCGCGCGCGGAGTCGCTGATGACGAGGATGGACGCGGCTGGCGTGCCGTTGGACAGCTTCTCCTTTAACACCATGATCGCGCTATACTGCAGGAAGGGGATGCAGTACGAGGCCATGTGCGTGCGGGAGCGGATGGACAATGAGGGGGTCAAGGCGGACGTCGTGACATGGAACTCCTTGATCCACGGCTTGTGTAAGGATGGGAGGGTGAAGGAGGCGGCGCAGCTTCTTAGGGAGATGATGGCGGCAGGGGTGGCGCCGGACCATGTGACATACACCACGCTGGTTGATGGGTACTGCCGGGTGGGCAATGTGGGGGAGGCTGTCAAGCTGCGAGAGGAGATGGAGGCAAGGGGGGTGCTACCGGGTGTCGCGACGTACAACGCGATTCTCAGGAAGCTCTGTGAGGATGGCAAGATGAAGGAGGTCAATGGGTTGCTTAACGATATGGATGAGAGGAAGGTGCAGGCTGACCACGTGACGTGCAACACGCTGATCAATGCATACTGCAAGAAGGGGGACATGACCTCAGCCTGCAAGGTCAAGAGGAGGATGATCGAGTCAGGGTTGCAGTTGGATCAGTTCACTTACAAAGCTCTCATCCATGGATTCTGCAAGGCCAAGGAGCTGGACGAAGCCAAGGAAGCCTTGTTTGAGATGATGGATGCAGGTACTCCAAATGTGTCTTATTTATGGTTTCAGCTAGTAGCATTAGCTCATCTTAAGGACTTTGTAACACCCCAGCCCATCCTCTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001563G0300 gene.
ATAAAACTTATTTGCGCACCCCTAATTTCTTTCTCCTCTTTTCCCCCTTTTTCTCTTCTTTCTCTTTCCTTCTTTTTCCTATCTCCTGGCCGAAGCCAGCCTCACCCGGCCTTATCCCTTCACCTCCCTTCTTCTACTCTTGCTCCCTCTCCCTCTCTTCTTCGCTTCCTCCAGAGATGCCTCTGCCTCCCCTCGGCTCCACTGCCTCCCCTCTGGTCGAGCCATGTGAGGACCCCGGCTTATTTGGCTTGTAATGCTTAGTCATCCATTGACCCTAGTATCACAAACAAAATAAGTCGTGTCTTCGAGATATGTATACTTCCCAGAAATGCAGTATACACACCATTTTACAAAATCATGCATCAATTTCATACAAGACATAGAACCAAAGCACGAACTAGATTAAACCAAAGATATACATAATAGCGAGTTATTACAAAAGGGGCCGACCGGCCAAATAACAACTAAGAAAGATAAATAACAGCGGAAGCAAAAACCATAAGATGGCGATAAACAAAAGCCATACGGTTTGCCTAAAGCCCACAAGGCAACCGACCGGGCCACCAAGCTAGTCGTCCCATCCACAGCACATCTCACAAAAGTAGGGCCCTTAGGGCTCCACCTCCTCTGCAACAAATTTATTAAGCAAAGCAAATGAGTACAAAAATGTACTCGCAAGACTGACGTGTAGTGTAACAGACCTATACATATGCTACATGCAAGCTTCTTTAAGTGGAGGTTGTAGGTTGTTTTCAGCATAAAGCAAGTTTTCATTTTCAATATGTAAAGAGATTCAAAGCAGTTTTACAATTCATATTTAATTTACAAATAACAGCGAGACAATAACAATATAACAATAGATAGATGACAACAACAATCCTGGAAGTGACTAACCCAATAGTCACCACAACAATAGCATGAATTACCCATTCATACCACCCATGTCAAGTTTTAATTAAAGGTTATACTCTAACTCTCGAAAGACCTCCCCAAGTGTGTCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001563 Download
Protein sequence
Protein sequence
MPPPPAGVDLTRALCATVIKSTFQPHLAAAPSLLAAVLHRLSPLPSAALAFFRSLPPPHPLDASLALLRLLASHPRHHPSARSLLRDLSLRHPLSSPLLLPSLLADPHIPSWLLLVLSQSARPHDAIRVFDHMRARGIAPDAHACTALLTALARSRMTATARKVFDEMARAGVAMNTHVYNAMLHVCLKAGDGARAESLMTRMDAAGVPLDSFSFNTMIALYCRKGMQYEAMCVRERMDNEGVKADVVTWNSLIHGLCKDGRVKEAAQLLREMMAAGVAPDHVTYTTLVDGYCRVGNVGEAVKLREEMEARGVLPGVATYNAILRKLCEDGKMKEVNGLLNDMDERKVQADHVTCNTLINAYCKKGDMTSACKVKRRMIESGLQLDQFTYKALIHGFCKAKELDEAKEALFEMMDAGTPNVSYLWFQLVALAHLKDFVTPQPIL
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above