gene PH01001360G0530
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001360:310926 - 312243(- stand)   Name
Alternate name Locus tag PH01001360G0530
Length of gene 1318  bp Length of CDS 807  bp
Product information
Feature type
CDS
Product name
ethylene-responsive transcription factor
Alternate name
Molecular weight
(predicted)
29222.9879199999  kDa
Isoeletric point
(predicted)
5.89324569702148
Length
268  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP06319530 PH01001360:311412 T T_C
PH01SNP06319540 PH01001360:311431 C C_G
PH01SNP06319550 PH01001360:311457 C C_T
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_137071 14
Please click OG5_137071 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT4G39780.1
Integrase-type DNA-binding superfamily protein
encodes a member of the DREB subfamily A-6 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are 8 members in this subfamily including RAP2.4.
Integrase-type DNA-binding superfamily protein; FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus; EXPRESSED IN: 15 plant structures; EXPRES
1E-47
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os03g09170.1 ethylene-responsive transcription factor, putative, expressed 6E-103
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 268
Detailed signature matches
    1. SSF54171 (DNA-bindi...)
    1. PR00367 (ETHRSPELEMNT)
    2. PF00847 (AP2)
    3. SM00380 (AP2)
    4. PS51032 (AP2_ERF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31657 (FAMILY N...)
  2. PTHR31657:SF0 (SUBF...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0003677 DNA binding
GO:0003700 sequence-specific DNA binding transcription factor activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 237985 93 153 2.47E-23 cd00018 AP2 cl00033 -
superfamily 241562 93 153 2.47E-23 cl00033 AP2 superfamily - -
non-specific 197689 95 154 3.72E-25 smart00380 AP2 cl00033 -
non-specific 216148 95 126 1.48E-09 pfam00847 AP2 cl00033 C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site R96,G97,R99,R101,W103,K105,E109,R111,R118,W120,T123 11 11 237985
 
DNA sequence
Upstream 1000 bp region from PH01001360G0530 gene.
CTCTCTAAATAATGTGGAGAAAATGCAAACCTAAAAAGTGAAACTAGTTTATAGAGCCACAGTGGACGCACATCCAACCAAACGACAAGTAGACAGGTATAACATCATATGAATTTGACATGCACTGGAATTTGTCGAAATGGAATTGATTTTGACACCATTGATATGAAGCGTCGAGACTCAAGCGGTAAAGAGATTTGGCAGGTAAGTCTCATAAATTCAGGTTTGCGCAAGAACATCATACTTTTTTGCAGGAAAGGAACAGCATCATCTAATTCCCAAGAGATAAATCAAGCAACTTTGTACTAAAATGCAATTTACAGCTTTGCAGTCAAATACTAGGAAATAATTTCATCATACTGATACTAGTTGAAAAATACTGCATGTTGAATAGATGACGGGTTATGCGTTCTCTTCATCGCTAAACATCGAACTTTTTTTATTAACCTTTTTTTTAAAAATTTATTTTAAAGTTAACTCCTGACGCACTTTATTTTTAATTCTGACCCCTTTGGTCACGCCATCACCTGTAACGTGACAAAACAACACTATCACGCCAACTCTTATCACGCCACAGATGGTGGCGTGACAGTATTGTTTGATCACGCCACGACCAGCGGTATGATAAAAAGTGATATTTTAGCGAACTTATTCTATGGCGTGACAATATTATTTTGTCACGCTATAGGTAATGACATGACCAAATGGGTCAGAATTGGAAATAAAGTGCGCTGAGGTTAACTTTAAAATAAAATTTAAAAAAAGAGATAATTAATAAAAAAATTCCTAAACATCCCACACATATTCTGTTCTTCGTTCTATTTGGTATCTTCTACATTTAGGAGCAAAATTGCATAACTTTACACCAAATTATGTTTTGTTTATCTTATAAACTCATGTGGCATACTCAAATTTCCATCACAGTTCTGCTATGCTATTCTGAACAGTAGCAGATGTACAGAACATGAACCAATAACCATTTGAATGTGCCAAAGTGGTTC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGACGACGACGATAGATTGGCACGGTTGCAACACCAATCTTCCTGCCGCTCTGTATGGCATGTTGGATAGCAAGCAGGTAATGCAAGCGCTTACTCCGCCCATGGTGCAAGATGCTCCGACCATCTCCTTCTCCTACCCCTGCTCCGGCGTGAAGCAGAGCGCGGGCTTGCTTCTTGGCGCCAACTACCAGCTGACTCCCGCGCAGATCATTGAAATCCAGTCGAAGCTCCACCACATGCGCCGGCCGTCCGCGCTCCCGGCGCGGCCGGCGGCCAAGCTGTACCGCGGCGTCCGGCAGCGGCATTGGGGGAAGTGGGTGGCCGAGATTCGCCTGCCCCGCAACCGCACCCGCCTCTGGCTCGGAACCTTTGACACCGCCGAGGAGGCGGCCCTGGCCTACGACAGCGCCGCGTTCCGCCTCCGCGGCGACTCCGCCAGGCTCAACTTCCCCGAGCTCAGGCGCGGCGGCGCGCACCTCGGCCCGCCGCTCCACGCCGCAGTCGACGCCAAGCTTCACGCCATCTGCCACGGGATGGACCTGCCGCAGCAGAGCCAGAGCACCACGACAGCGGTGACGCCGAGTTCTTTCTCCTCCGAGAGCCCCGACGTCAAGAGCGAGCCGGGCTGCTCCGGCTCCGAGAGCTCGTCATCGGCGGACGGCGACGTGTCCTCGACGGGCTCCTCCGATGTAATCCCGGAGATGCAGCTTCTTGACTTCTCGGAGGCGCCATGGGACGAGTCGGAGAGCTTCCTGCTGCGAAAGTATCCGTCGCTGGAGATCGACTGGGATGCGATCCTTTCCTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001360G0530 gene.
GGTGAGCAAGAGCAGCCATTGCCGGGCTCTTTTATAAGCACGCGGGAGGTAGGTGTTGGCCAATGGGAGAACGCCAGGTGTCCGCGCAGATTTCTTACTGGCACCTGTCGAGACGTCTCCACGCAGTGACAGACCTCTCCAGGCAGGTGCCGGTAAAACGATGGGCACCTGGCGGCTGCTGATTGGCTGACAAGTGGTTTTGACATGGGCCTTGTTTGGCACATCCGTGGAAAGACGGCTTCCAGCTGGTCTGTAGTACTGAACGGCTAGTTTGAAAAGGTTTATTGTTTAACTATTCGGTTTTTAGGTAAATTGGTTGTAGCTTCTGAGATAAAAAATGTCTAAAATACCACTGATGACAGTACTAGCTTGTTTGATATCATTTAACGCAATTAACAATATTTAACGACAATTGACGACTATTAATGACGACTAACGCAATTGACGACAACTACCGTAGCTGACGAGAATTACCGCAATAAACGACAACTACCGTAATTGATAATAATTAGCTGCAATTAACGACGATTAACACAATTGACTGCAATGAACGATGACTACCGCAATTGATCGCAATTAACGACGATTAACGATAATATATCGTAAACAACGCAATATACCGCGATTAACAACAATATACCGCAAACAACGCAATAAACTGCTATTAGTGTATTTAACGATAATTATTACAATAAACATTTATTACAACTAATAATTATTTAAAAAAATATTACAGTAAATAATTATTAAGATAAACAATTATTACATAAATAGTTATAACAATAATTAATTATTAAAAACAATTATTACAGTGAATAATTAATACAACAAATAGGGAAAAAACAGGGTCGGCGGTAACGGCTAGGGTTTGAGTCGACGCTGCTGGCGACGCCAGGAGAGGACTTGGGTGGCGGGGTCAAGGGAGGAGGTCGGCGGCCGGGCTAGCATGGGGTAGAGGGAGGAGGAGGGTGACGGCCGCGGGAGAAGGAAGGTGGAGGAGG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001360 Download
Protein sequence
Protein sequence
MTTTIDWHGCNTNLPAALYGMLDSKQVMQALTPPMVQDAPTISFSYPCSGVKQSAGLLLGANYQLTPAQIIEIQSKLHHMRRPSALPARPAAKLYRGVRQRHWGKWVAEIRLPRNRTRLWLGTFDTAEEAALAYDSAAFRLRGDSARLNFPELRRGGAHLGPPLHAAVDAKLHAICHGMDLPQQSQSTTTAVTPSSFSSESPDVKSEPGCSGSESSSSADGDVSSTGSSDVIPEMQLLDFSEAPWDESESFLLRKYPSLEIDWDAILS
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above