gene PH01001303G0110
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001303:71439 - 74283(- stand)   Name
Alternate name Locus tag PH01001303G0110
Length of gene 2845  bp Length of CDS 396  bp
Product information
Feature type
CDS
Product name
OsMADS37 - MADS-box family gene with MIKC* type-box
Alternate name
Molecular weight
(predicted)
14929.0585199999  kDa
Isoeletric point
(predicted)
9.94215011596679
Length
131  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP06129550 PH01001303:73287 G G_A
PH01SNP06129560 PH01001303:73312 A A_G
PH01SNP06129570 PH01001303:73535 C C_T
PH01SNP06129580 PH01001303:73771 T T_C
PH01SNP06129590 PH01001303:73889 C C_G
PH01SNP06129600 PH01001303:73932 C C_A
PH01SNP06129610 PH01001303:73964 G G_T
PH01SNP06129620 PH01001303:74029 T T_C
PH01SNP06129630 PH01001303:74055 T T_A
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_129613 2
Please click OG5_129613 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os08g41960.1 OsMADS37 - MADS-box family gene with MIKC* type-box, expressed 5E-53
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 20 40 60 80 100 120 131
Detailed signature matches
    1. PF00319 (SRF-TF)
    2. SM00432 (MADS)
    3. SSF55455 (SRF-like)
    4. PS50066 (MADS_BOX_2)
    5. PR00404 (MADSDOMAIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR11945 (MADS BOX...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding
GO:0046983 protein dimerization activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238165 35 103 4.70E-34 cd00265 MADS_MEF2_like cl00109 -
superfamily 241616 35 103 4.70E-34 cl00109 MADS superfamily - -
non-specific 197721 35 92 1.36E-28 smart00432 MADS cl00109 -
non-specific 238067 35 92 6.68E-28 cd00120 MADS cl00109 -
non-specific 238166 34 99 1.89E-24 cd00266 MADS_SRF_like cl00109 C
non-specific 109379 41 91 1.12E-20 pfam00319 SRF-TF cl00109 -
multi-dom 227400 28 92 1.89E-12 COG5068 ARG80 - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site R35,G36,V38,L40,D45,T47,V51,R52,K55,R56,S58,G59,K62,K63,Y65,E66,L70 18 17 238165
specific putative phosphorylation site S91 1 1 238165
specific dimerization interface F53,L60,F61,A64,Y65,L67,S68,C71,A76,V78,F80,L86,E88,I96,I99,F100,Y103 19 17 238165
 
DNA sequence
Upstream 1000 bp region from PH01001303G0110 gene.
AAGAAAAGTTAGGGTTACACTGGAGTCACCAAACCACACGAGGCCGAGGCATGGAACCGAAGTTGAGGCACCAAGCGACGCAATCCCCAACATTGGGCAGCACAAGTCACTGGCACAGACCAGCACCAGAGAGATCCAACACGTCTTCTTGCCTCCGATCTACCACTTCTTCCATGATGTTCACCCGATCTAACATGGGGTAACTTCATGTTCTTCCTCGAGTTTTGGGGATCTTGCTATGTAATTCACAATGTTTTTTTTATCTAAGCTACTATGGTACTTTTTGCTATGGTTAGCCTTGTAATACCATGACTCAAAATCCGCTCAAAGCCCAGCCCACCATAGGGCGTGCCCACGCATGCAAAGCACCCGCTTACACTTTCGTCAGCCCTTCATGTAAAAGGGTTAACTTGAAGGTGCTATGTTTAAACCTAACAAATATTATATGCTATTACAACCCACTTTAGACAAGCAATGTGGGACTAATCCCACCACAATTCTACATGGTCGCACTCTAATAAGTCAGGGTATTACAAGTCTACTTATTATCATGTTAATTAATTGATGTGACGTTCTCGTTTTGTTAATTGTTAGACTTGAGCATGGTGTTTAGGTCTAGTCATCCGATCTATAACAAGTAGTGTAGAGCTTGCTGTTTTAGATTAACCCTAGTACGTGACAGGTGCGAAGGTGAAAAGAGCAGTATTGATTAGTAGGATGAGAGCTATCTTAGCATATTACCAATTCATAGATTAATTTATCTTTTGTCTTTATGCATGTAAGTGAACCTAGACCTAGGTAGGAATTGCTTAGACTTCAATAAAACCTAGATAGTTTCGAATTACGGTGTTAGCTTTAATACAATCTTTCATACATCGTTCTATTAGTAGTAATAGTCTACGGTAGTTGCGATACCATCTGTTCCCTGTGATTCGATACCCTAGGATACTCAGGTGAAAAGCTACACCTCATCTGTGCGTTTGCGGCTTAATTATTGCACG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGAGGGGGAGAATGTGGTGGGGAGGAGATCAGTGCAGGCGGCGGCGGCGGGGCAGGAGGGGGAGGAAGGAGGGATGACGAAGCACAAGGTGAAGAGGAAGCGCGGGCGGGTGGAGCTGCGGCGGATAGAGGACCGGACGAGCCGGCAGGTGCGCTTCTCCAAGCGCCGGAGCGGGCTCTTCAAGAAGGCCTACGAGCTCTCCGTGCTGTGCGATGCCGAGGTCGCGCTCGTCGTCTTCTCCCCCGCGGGCCGCCTCTACGAGTTCGCGTCATCCAACTCCAGCATTGAGAAAATTTTTGGTCGATACTGGGACATTCCCAACACAACAAACCATCTAAATATTGAAGCACGAGACTCTCGGGTTGATTGCAAAATACAGGTCAAGCATATGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001303G0110 gene.
GCTACTTGTTTCTTTCTTGCCCATATATAGTGGTGTGTAGTCTCTTTCTTTTCTTCGTCCTCGGATGCATAAATTGTTGACTTTTATTGCGATTCGAATTTCGTTTTCTAGTTTAATTTGTAGTCCTAATTTTATACAAATCTCACGTGTACCACTATAAATATATTTATATTGTCCATAAAAAACAGTAAGAACATTATTATAAACATATCCTCATATAGTAAAATTGTCTTCGTATGTCTGTTTCTTTCAAAAGGGTTTTTTTACATAAAATTTGTGTCTTCTGTTTCTATTTTGTGTTATTTTAACGTAAATGCATTGGCACAAATTGAGTTTTTTAGCTTAATTAGCACTGTTCTACAACGAAATAGCAAAAATTGCTCCTCCCCACGAGTGAGTGCAAAAACGGTACCACAAACATACCAGCAAACGACACGTGCTCCCTGCCTTGCCCCACCACGCAGCAGGCCACCTGCGTGGAGGCGCGGCAGGCCAGCCGTCGCTAAATGGGAGCCCATCATGTGGCCTACTGCACGTCCAAGACATAATAAACCTCTCTCGTGATATTTGAGCGAGAAATCGGTACTATTTTTTATCACGAGCAGAGAGCTATTCTTATTATTTTGTGACGCAACGATGCTATTTAGCCGTCACGCAACACTGCTATTTAGCCAATAACTCACACATTAACACTTGCTGCAAAAGCTTAGCCAAACTGTATACGGTCTGTGCTTGCTAGTTTTAAGCAAGCTATTTTTCTTACTCTGTCAAAAATGTCGTATGTTACGCGCCTTAGCTTGCCAACCTAATGATGGTGACGGTGACAAATCGTCCCTGACTGCCCTTTTTGAGGGCGACGGCATAGTGTGGTGGCTAGCTGGTGGTGGTACACATCGAAGGATGAGCAACGCAGGCGCAAATGAGTTTTTTTTTCTCTAGTATTGGCGCAAATTCATCTTGTATTTATAAGATTAATTATCTTCGCATGAAATTTACAAAAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001303 Download
Protein sequence
Protein sequence
MEGENVVGRRSVQAAAAGQEGEEGGMTKHKVKRKRGRVELRRIEDRTSRQVRFSKRRSGLFKKAYELSVLCDAEVALVVFSPAGRLYEFASSNSSIEKIFGRYWDIPNTTNHLNIEARDSRVDCKIQVKHM
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above