gene PH01001215G0490
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001215:364609 - 366337(+ stand)   Name
Alternate name Locus tag PH01001215G0490
Length of gene 1729  bp Length of CDS 558  bp
Product information
Feature type
CDS
Product name
DnaK family protein
Alternate name
Molecular weight
(predicted)
19765.0522199999  kDa
Isoeletric point
(predicted)
4.7397346496582
Length
185  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP05874500 PH01001215:364616 T T_C
PH01SNP05874510 PH01001215:364686 G G_C
PH01SNP05874520 PH01001215:365614 T T_C
PH01SNP05874530 PH01001215:365743 A A_T
PH01SNP05874540 PH01001215:365790 T T_C
PH01SNP05874550 PH01001215:366023 C C_T
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_126744 10
Please click OG5_126744 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G09590.1
mitochondrial HSO70 2
heat shock protein 70 (Hsc70-5); nuclear
mitochondrial HSO70 2 (MTHSC70-2); FUNCTIONS IN: ATP binding; INVOLVED IN: protein folding, response to cadmium ion, response to salt stress, response to virus, response to heat; LOCATED IN: mitochondrion, cell wall, plasma membrane, chloroplast, mitochon
1E-90
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR19375 (HEAT SHO...)
  2. PTHR19375:SF1 (HEAT...)
  3. SSF100920 (Heat sho...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
multi-dom 234715 1 185 3.42E-80 PRK00290 dnaK - N
multi-dom 233830 1 156 1.78E-66 TIGR02350 prok_dnaK - N
multi-dom 215656 1 156 8.92E-63 pfam00012 HSP70 - N
multi-dom 240403 1 156 6.89E-58 PTZ00400 PTZ00400 - N
multi-dom 215618 4 156 3.42E-49 PLN03184 PLN03184 - N
multi-dom 214360 1 154 2.06E-48 CHL00094 dnaK - N
multi-dom 184039 1 153 3.54E-48 PRK13411 PRK13411 - N
multi-dom 223520 1 154 8.68E-43 COG0443 DnaK - N
multi-dom 140213 1 154 1.12E-39 PTZ00186 PTZ00186 - N
multi-dom 184038 1 138 8.74E-39 PRK13410 PRK13410 - N
multi-dom 240227 1 156 8.24E-36 PTZ00009 PTZ00009 - N
multi-dom 233673 1 143 1.54E-29 TIGR01991 HscA - N
multi-dom 235360 1 148 1.92E-28 PRK05183 hscA - N
multi-dom 234955 1 143 5.27E-17 PRK01433 hscA - N
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01001215G0490 gene.
TACTGTTCCAGCTTATTTCAATGATGCTCAGCGTCAGGCTACCAAGGATGCTGGCCGCATTTCTGGACTTGATGTCCAAAGGATCATCAATGAACCAACTGCTGCTGCTCTGTCTTATGGAACAAACAACAAGGAGGGTTTGATAGCTGTATTTGACCTTGGAGGAGGAACCTTTGATGTGTCCATTCTAGAAATCTCCAATGGGGTGTTCGAGGTCGGTATCTATAACTTCTTACTAGTAACTTACTGTAGTAAGAAAAATTGTTACATAGAACTTCATCCCCCCTGATCTGTTGATTATGTTGATGTCAGGTCAAAGCAACAAATGGTGACACTTTTCTGGGTGGAGAAGACTTCGATAATACTCTATTGGAGTTTTTAGTGAGTGAGTTCAAAAGAACTGAAGCTATTGATCTGTCAAAGGATAGACTGGCTCTGCAGAGGCTACGTGAAGCAGCTGAGAAGGCAAAAATAGAACTCTCATCAACAGCCCAGACTGAGATCAATCTTCCATTCATCACAGCTGATGCCTCTGGAGCAAAACATTTGAATATTACACTGACAAGATCAAAGTTTGAATCTTTGGTGAATAATCTGATTGAGAGGACTAGAGACCCATGCAAGAACTGCTTGAAGGATGCTGGTATAAGTACTAAGGATGTTGATGAGGTCCTTCTTGTTGGTGGAATGACAAGGGTTCCAAAAGTGCAGGAAGTGGTTTCTGAAATCTTTGGTAAGGCACCTAGCAAAGGAGTCAACCCAGATGAAGCTGTGGCCATGGGTGCCGCCATTCAGGGTGGCATTCTCCGTGGAGATGTAAAGGAGCTGCTTCTACTTGATGTTACCCCTCTTTCACTTGGTATTGAGACTCTTGGTGGTATCTTCACCAGACTGATCAACAGGAACACTACAATCCCCACAAAGAAAAGTCAGGTTAGTAAGAATGGTTTTACTCCTCCTGAACTAGGATAGCGTTTCTTAACTACTATTATACTGTTATT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGACAGACAACAAACTTCTAGGTGAGTTTGATCTTGTTGGCGTTCCACCAGCACCAAGAGGCATGCCACAGATTGAGGTCACATTCGACATCGATGCCAACGGGATCGTGACAGTCTCTGCAAAAGATAAGGCAACTGGAAAGGAGCAGCAGATCACCATCCGATCCTCTGGTGGGCTTTCTGAGGCTGAGATTCAGAAGATGGTCCAGGAGGCTGAGCTGCATTCCCAGAAGGATCAGGAACGGAAAGCTCTCATTGACATCAGAAACACTGCAGACACCACCATTTACAGCATTGAGAAAAGTTTGGGAGAGTACAGGGACAAGATTCCTGCAGAGGTTGCCTCCGAGATTGAGACGGCAGTTGCTGATCTCCGCACAGAGATGGCCTCGGATGACATTGAGAAGATAAAGAGCAAGATCGAAGTGGCCAACAAGGCTGTCTCAAAGATCGGGCAGCACATGTCTGGTGGTGGGTCTGGTGGCTCGCAGTCAGGATCACAGGGCGGAGGCGACCAGGCTCCAGAGGCTGAGTACGAGGAGGTCAAGAAGTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001215G0490 gene.
AAAAAATTGGGCGACATGCGTCGGCATCCTGAATGAATGAATCACCGAATTCGAATCCACTGCACAAGGAAAAAAACATTGGTGCGCAGGATAAGATAATCCCACACGTCTTAGCCCACCACTTGCGATGTTAACCAACTAACCCTAGGAGACTTCTCGAGACTGGTGTGAAGAGATAAGACGTATTTCTTGCATACAACATATTTATTATTTAAGAAGGGATGATTCGAAACCAGATTGGCTAGCTGCGGTGCCTCGTGTCATTATCCCGGAGGGTAATCACACTTAAATATACGGATTATTATTCGTCTGCCCGGTAGGACACCGCTCCAGCGAATAGTAAGTTTTACCAGAGTTAACATAGCAGGACAATAAGATAGAAGATGCACTTTTATTACAGTAGTTAGCCACGCAAGGTTATGGTCTTACAATTATTTAATTTACAACAGGAAAGAAAATCCCCTCGCTTGCCTGCCCTGCTCTACCGGTCGTCTATTCGTCTCCACCTCGCCCTGGACCTCGTAGTAAGCGCCCTCGCCTCCTACGGCCTCCTCGGCACTTGCGTATCCTTCATCCCATTCTAGATAGTTACCGGTCGGACTAGGATCTAACAAAGCAGAATAATAGCAAGAATGAGTACTAGTGTACTCAGCAAACATTTATTAGCACAGATGTACTGTATGACCATTCTCTGTTCGTTATCACATTTTCTAACTCATCTCTTTTCTAGAAAATAATTTACCAATATTTAAGTGGCAGTTTTAATTCTGAAAAGACTACTTATCATTCGGAGAGAAGATAGACCCATAGCGGTTCCACTAGACTCTAATCTAGGAGACATGCATGAATTCATGATTTTGTATAGCACTGCGCAGGCTTTGTACTACTTTACCCATAGCTACACTGAGCTCTCTTTACGCTAGGCCTCTCGTATTTTCTTTGATGCGGTTTCGAGTTCAAAATACAAAACGTTTTCCAGGTTACATGATTAATTCTCCACC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001215 Download
Protein sequence
Protein sequence
MATDNKLLGEFDLVGVPPAPRGMPQIEVTFDIDANGIVTVSAKDKATGKEQQITIRSSGGLSEAEIQKMVQEAELHSQKDQERKALIDIRNTADTTIYSIEKSLGEYRDKIPAEVASEIETAVADLRTEMASDDIEKIKSKIEVANKAVSKIGQHMSGGGSGGSQSGSQGGGDQAPEAEYEEVKK
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above