gene PH01001131G0040
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001131:23857 - 24659(- stand)   Name
Alternate name Locus tag PH01001131G0040
Length of gene 803  bp Length of CDS 498  bp
Product information
Feature type
CDS
Product name
hsp20/alpha crystallin family protein
Alternate name
Molecular weight
(predicted)
17823.4768199999  kDa
Isoeletric point
(predicted)
5.94734573364257
Length
165  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_155411 3
Please click OG5_155411 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G12020.1
17.6 kDa class II heat shock protein
17.6 kDa class II heat shock protein (HSP17.6II); CONTAINS InterPro DOMAIN/s: Heat shock protein Hsp20 (InterPro:IPR002068), HSP20-like chaperone (InterPro:IPR008978); BEST Arabidopsis thaliana protein match is: heat shock protein 17.6A (TAIR:AT5G12030.1)
2E-49
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g08860.1 hsp20/alpha crystallin family protein, putative, expressed 5E-56
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 20 40 60 80 100 120 140 165
Detailed signature matches
    1. SSF49764 (HSP20-lik...)
    1. PS01031 (HSP20)
    2. PF00011 (HSP20)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR11527 (SMALL HE...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 215655 57 163 2.30E-28 pfam00011 HSP20 cl00175 -
superfamily 241659 57 163 2.30E-28 cl00175 alpha-crystallin-Hsps_p23-like superfamily - -
non-specific 107229 57 146 2.18E-25 cd06472 ACD_ScHsp26_like cl00175 -
non-specific 107221 57 146 1.57E-24 cd06464 ACD_sHsps-like cl00175 -
non-specific 107228 56 146 5.78E-16 cd06471 ACD_LpsHSP_like cl00175 -
non-specific 107219 58 146 6.91E-15 cd00298 ACD_sHsps_p23-like cl00175 -
non-specific 107247 65 146 6.76E-06 cd06526 metazoan_ACD cl00175 -
non-specific 107227 65 144 0.00353127 cd06470 ACD_IbpA-B_like cl00175 -
multi-dom 223149 45 146 1.10E-17 COG0071 IbpA - N
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01001131G0040 gene.
AGACGAAACGGTGTAGCTACGAACCATCTCTATCCAATTTTCTGTGTGATTCTTGTTACTTGTACTTATGTGGTAACCGAATTCAATTCGACCGAGTGTGAATGTAGTGAAGTTTTTTTTTGTTTACATTAAAAAATTACTCCCTCCGTTTATTTGTACTAGGCAATCATTTGTTTTTATATAATACTCTATCAGGTCACAGAAAAGAGTTATAATAGTGCAATATTATGAAAGTATTTTTTATGATAAATTCATCCATACTATTTTCATAAATCCAAACCATATATTTTAAATAAAACCTTTGATCAAAATTAATACAATTTAACTACACGTATTCTAGGGTGTCACTCTTTTGTGATTAGATAGATCCAATACATCATGGACCCACCAGAGTTATAATAGTGCAATATTATGAAAGTATTTTTTATGATAAATTCACTCATACTATTTTCTTACATCTAAACCATATATTTTAAATAATAACCTTTGATCAAAACTAATAGAATTTAACCACACGTATTATAGGGTGTCACTCTTTTGTGATTAGATAGATCCAATAGACCATGGACCTACCAAATATGTGGTGCGGTAGGGTTCCAAATTTCGGTACTACTGGCAGGACCGGTAGGAATACAAACTGAACAAAAAATTCGGTTTGGATGAATTTTGCCCAAAAAATTGAATTTTGCTTGATTTTGATTTTTTTTAATTTTAAAATCCGAAAACATAAATTAAAATCTGGCCACCTCCGGTAAAAAAATACCGGTTAAAAAACCCTGAGTGGGGGTGGGAGAAAGGAAGGAAATGAATGAGGGCGAGAAATACGAAAATATGCATTGAAAACAGGCCTCTAACCACATTTTCGTTCAGGTGCAAGCACCAAGGTTAGTAAGCAACAGCCTGGGTTTCTTGAATTGCCACCGATAATTACTCTGCTTTCAACATAGTTTGCACCAAACGCACATCCATTATTCCTTTTGTTTGCAAAATCAAACGTAGAT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGACGTGAGGACGTTCGGGTTCGAGGCGCCGGTGATGTCGGCGTTGCAGCACCTGCTGGACCACGTCCACGCCGACGAGGCGGCGGCGGACAAGGCCGGCGGGAGCGCGGCAACGCCCACCCGCGCCTACGTCCGCGATGCGCGCGCCATGGCGGCCACCCCGGCGGACGTGAAGGAGCTGCCCGGCGCGTACGCGTTCGTGGTGGACATGCCAGGGCTGGGCGCCGGCGACGTCAGGGTGCAGGTGGAGGACGACCGCGTGCTGGCCATCAGCGGGGAGCGGAGGCGGCCGGACGAGGAGGAGGCGGCGGGCGCCAGGTACCTGCGGATGGAGCGGCGGATGGGTAAGCTGATGCGCAAGTTCGTGCTCCCGGACGACGCGGACGTGGGGAAGGTGTCGGCCGTGTGCCGGGACGGCGTGCTGACGGTGACCGTGGAGAAGCTGCCGCCGCCGGAGCCCAAGAAGCCCAGGACCATCCAGGTCAGCATCGCCTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001131G0040 gene.
GGAGAGATGTGGCGAGCAGCGAGGGATTTATATAGATTTGCAGTGGCTTGCGGGAGAGGGTGTTCTGGAATACGATGGAAGGTTCTGACAGGTTCTGGAATGAACCTTTGAAGCTGTACCAGTGTAGCAGTGTGTTACCGGAGAAAGATCTGGAAGCTTGGTCTTTCTTTAATGGTTTCTTCGGGTGGGCCTACGTATGACTTGCCAGCTTTAGCCAAGTTAGATATTTGGCGAGTCCAGTAGATTCTAGAATTCTCGCAATCTCGAACCCCTCGTGGGCTTCCTGTTCGAGAAGCTTCTTCAATCTCCAGTTACTTCTATTTACCCAGATGGAAGAAGCTCCTTGTATTGTGCCGACGTCAAAAAGTATAAATCATAATTATTCATTGACCAAACAATATTCATCTGACCATTGAACAATATCCAACCATTGAAGTAATAATCCAGCAACAAAACATCTCAAGTTAAACTAGGCTTTGGAACTTGGCCAGGTTGGGCCTAGATCTTGGGTTTGGCTAAGCTTGATAGGCTAGGTACCTTGGTTAGGCCTACAATGGAATCCGCCGTTTGGACTAGGTTGGTGCGTACAGCAGCTCTACTGGTCCTGGTTAAAAGAGGAAAAAGAAAAAGGATTTACTGAAATTTGTCTCCTTTTTTCTGTTTCTTCTGATATGGATCGCGTTTTTAGTTGAATTTTTGCAAGATGCTAGATTATATCTTGATCTATCTAACCTTTTCTTTTCTTTTTTAGAATTTGTCGTGACTATTTGCATCATTTTTCCAAGGGCGGGAGAACGGTAGCACCGGAGGGACAGGAGCACTGAATATGTTCTCATGGTCATAGCTGGAGATGTGTCAGCAAATTTAGGGGAGTGAACTAAGGCCATGTACAATGTGAGGAAAAAGAGGTGCTAGAAGAGGAGAGAAAAGGTTAAAGCACCGGTTCACACATTGCAGGAGACGGTGCTAGCATACAAAATCCTAGAACTGGCGAAGCAAGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001131 Download
Protein sequence
Protein sequence
MDVRTFGFEAPVMSALQHLLDHVHADEAAADKAGGSAATPTRAYVRDARAMAATPADVKELPGAYAFVVDMPGLGAGDVRVQVEDDRVLAISGERRRPDEEEAAGARYLRMERRMGKLMRKFVLPDDADVGKVSAVCRDGVLTVTVEKLPPPEPKKPRTIQVSIA
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above