gene PH01001118G0090
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001118:52761 - 57528(- stand)   Name
Alternate name Locus tag PH01001118G0090
Length of gene 4768  bp Length of CDS 1716  bp
Product information
Feature type
CDS
Product name
expressed_protein
Alternate name
PAP
Molecular weight
(predicted)
63806.5615200002  kDa
Isoeletric point
(predicted)
8.47803115844726
Length
571  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP05519990 PH01001118:53194 G G_A
PH01SNP05520000 PH01001118:55484 A A_C
PH01SNP05520010 PH01001118:56348 T T_G
PH01SNP05520020 PH01001118:56472 A A_G
PH01SNP05520030 PH01001118:56939 G G_A
PH01SNP05520040 PH01001118:57162 T T_C
PH01SNP05520050 PH01001118:57337 G G_T
PH01SNP05520060 PH01001118:57516 A A_T
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_127104 9
Please click OG5_127104 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT2G25850.1
poly(A) polymerase 2
Encodes a poly(A) polymerase. Located in the nucleus.
poly(A) polymerase 2 (PAPS2); CONTAINS InterPro DOMAIN/s: Poly(A) polymerase (InterPro:IPR014492), Nucleotidyltransferase, class I, C-terminal-like (InterPro:IPR011068), Poly(A) polymerase, central domain (InterPro:IPR007012), Nucleotidyl transferase doma
3E-173
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os06g36360.1 expressed protein 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
1 100 200 300 400 500 571
Detailed signature matches
    1. PF04928 (PAP_central)
    1. SSF55003 (PAP/Archa...)
    1. PF04926 (PAP_RNA-bind)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR10682 (POLY(A) ...)
  2. PTHR10682:SF5 (POLY...)
  3. SSF81631 (PAP/OAS1 ...)
GO term prediction

Biological Process

GO:0031123 RNA 3'-end processing
GO:0043631 RNA polyadenylation

Molecular Function

GO:0003723 RNA binding
GO:0004652 polynucleotide adenylyltransferase activity
GO:0016779 nucleotidyltransferase activity

Cellular Component

GO:0005634 nucleus

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 218331 215 351 2.23E-53 pfam04926 PAP_RNA-bind cl08427 -
superfamily 218331 215 351 2.23E-53 cl08427 PAP_RNA-bind superfamily - -
multi-dom 240410 54 391 9.58E-102 PTZ00418 PTZ00418 - N
multi-dom 203124 56 214 2.13E-91 pfam04928 PAP_central - N
multi-dom 227513 57 352 7.06E-68 COG5186 PAP1 - N
multi-dom 233280 200 262 0.00207322 TIGR01128 holA - NC
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01001118G0090 gene.
GGTGATGTTCTCGTAGTATGCACGAATAAGTGGTAAGAAAAATCGTGTTAATCCTGTGATTGTTGTGTTTGAAATAGATGATAAAAACTCTTCATACTCATTTGTAAAAGGGTACTTCAGACATTCATCATTGAAGCCAATAAGCCAACCCAAAAAAAAACAGACTACCAAACAGGTTGGCTTAGCTTGGCTTAAAAGCAGACTTCTTATTTCATCATTGAAGCCAATAAGCCAACCCAAAAAAAAACAGACTACCAAACAGCTTAAAAGCAGACTTCTTAGAAACTACTCAAGCCAAAAGGCTAGCTTTAAGCTAAAAAGGTTAGCTTAAAGCCCAAACAACCAGGACCCATATAACCGTAAGTAACACAGGCATGAGCCACCGTTAACTCTATCAAAATCACTTCAAAGAAAAGAGGAAAAGAATGGCGCCAGCCAGAATGCAAGGAACAGTCTTGCAAATTCTTATATTATTTAGTTAGGAAGAGTACAAGGGGGCCTTGAGAAACACAGATAGACAGCATCACATCTATTTCTAATCTAGACCTACAGCTGGGCAGGGCATCTCTGAGAAGCAAACAAGTCAACCCAGGGAACCTGCTAGACTTCAGTTCATACATTTGAGCCAGCTGCTCCACAACACCAGACATAACCGACAACTGAAGTTGCNNNAACCCAGGGAACCTGCTAGACTTCAGTTCATACATTTGAGCCAGCTGCTCCAAAATACCAGACATAACCGACAACTGAAGTTGCTGAGCCTGTAAAAAACACTAGCCATAGATCTAGACTTTCTGGCACACAGTTTATGCCCTTCCACGAAAGAAATTTTCCTTCTTGTTTTTGCCATGTCATTGCACGACATGATTTTACCACCGTCTTCCTTCAAGAGCCCCCGATGCTGGCAGATCTGTGTCGAAAAGGAAACTTTATGAGTCGAGCAACTTACCAAATAGACACCAGACCCTCCATTCCATCCAGCAGAAGCGGTACTTGTTCCT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGAAGAGCTTGGTGGCTCCGCCAGGCACCATGATCCGGGGCGGCGGCGAGGAGTTGTGGAGTGCCGACCTGTCCAAGTTGGAGACCGGGAGGAAGTTCGCGTCGGGCAGACACAGCCGCGTCTACTTCGACAGGTACGGCCGTCGTGAGGTGGCCATCAAGATGAACTTTCGAACAACACTAAGGTGTTTGAAATACTGGGCAAAAAGAAGAGGTGTTTACTCTAATGTTACTGGTTTTCTTGGGGGTGTCAATTGGGCTTTACTGGTCGCACGTGTCTGCCAACTCTATCCTAATGCTGTGCCGAGTATGCTGGTCTCAAGATTCTTTAGAGTTTTTACCCAGTGGTGCTGGCCAAATCCAGTGATGCTCTGTGCCATTGAGGAGGATGAGCTTGGTTTTCCTGTGTGGGATCGACGCAAAAATCCTCGTGACAGATCTCATCATATGCCCATTATCACCCCAGCCTACCCATGCATGAACTCCAGCTATAATGTGTCAACAAGCACATTGAGGGTTATGATTGAGCAATTCCAGTTTGGTAATAAAATTTGCCAGGTAATCTTCTTTGCCACCACAGAAGCTACTATTGCAGAAATTGAGCTGAATAAGGCTAATTGGTCTGCCCTTTTCAAGCCTTTCCAATTTTTTGAAGCGTATAAGAATTATCTACAGGTTGACATCATCGCCGAGGATGATGAAGATCTTAGACTTTGGAAGGGATGGATTGAATCTCGATTGAGGCAACTGACTTTAAAGATTGAACGGGACACATATGGAATGTTGCAATGCCATCCTTACCCACATGAGTATGCAGATCCTTCTAGACAGTGTGCTCATTGTGCTTTCTTCATGGGCTTATCAAGGAAAGAAGGTGTAAAAATACAAGAAGGTCAACAGTTTGATATTCGTGGAACAGTAGATGAGTTTAGGCACCAAATCAACATGTATATATTCTGGAAGCCTGGGATGGAGTTAGCTGTTTCTCATGTTCGGAGGAAGCAGATTCCATCTTATGTGTTTCCAGAGGGTTACAAGAGACCTCGTCCTTCAAGACACGCGAATCATCAGCAGCAGTCTGATAAAAATGACATTGAAAATGGCACAATGACTGGATCTCCGGATGGTCAGGTCAAAAGAAAGCTTGATTCTGCTGGTTCTGATGACACTGAACCTTGCAGATCTGTTAAGAGGGCATCAGTCAGCCCAGTTCCCCCGAAAACTTCATCACCTCAATCTGGGAATGTTGGTGATGAGACCAACCAAACAGAAATGGCTTCTAGTGTGAGTGGTGGCAGTCAGACTTCACTTGGCACTGGCAATCTCGAAAAAGCAAATTGCTCGAGTTCACCGCAGGCATCTGAGAAAAGCTTGGATTCTGTCGCATCAGGCTCCAAGTGCGCGACAGGGGGAGAAGTTTGTTCTGGTGACACAACTAGCAAGCATGGTAACTGTGTTTCCCATGTCAAGAAGTGCACCAGTCCAACCGTAGCAGTATGTACAACTTTAAAGCGTGTTGCCGAGAAGGTTGTATCAGAGCTCGTTGGAAGTGAAAGCTTGGGAAACAGCAACAGTGCAGAGTTACTGGAGAGAGCAGACAAGGACATGGGAAATGTCCTTGTTGAAAATGTGCATTTCGATGGGAATGGAGTTGCATCGAGTGGTCTTCCGGAGGAGTTAGAGGTCTTGCTTCTGGTGCATTCTCTCCTTTTTTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001118G0090 gene.
GAGGAGGGTTGTTAAGGATATAAGGGTATTTATGGTATTTCCTATTGTATTAGGGTTTAGACTTATGTCCCTTTGTACCCTATATATATTGCCCATTAGGCCTCTTCAATATACACACAATACAAACAAAATATGCTTAACGAAGATTCAAGATACAAGTTAAAATATCGCATAAACCATGTTCTATATAGACAAAAGCTCATAAAGTATGCATAAAGAAACAAGTGAGTACACAAAAATATTTAGCGGAACATAAACTTACTGGTGGTACTACTAAGAGAGAAACACTGGCATAAAGAAGGTCAATTGATATTCCATGGAACTTAAATTTCATAACAGGGACATGTGCACCAGGTACAGGTTGCAGTTCAGTCACTTCTTCAGTTTGGGCTAATATGCCACGTAGTACAATAAAGAAATCTTCCTGCATAAAGAATACCACGTTAGCAAGCACGAATGCTATATCTAACAAATAAACCATACTGAGAGCACACATTCCTAAAAGAAGACATCACCTCGCGATTCACATATGAAGGTCCAATGCATAAAGTATCAATGTCAGCCCTAGGTCCATGAACCTGTAAAAACAGAAACATCAAATTATGCACAGGTGAATCATGCCATAAGAATGACAAACATAAGTATGCCAGAAACATAAATAACACGGTATATTGAAGAAAAAAAACCGTTCTATGTGACAACATATATAGAAATAATAATAATTCAACAGATGCAGAACAGAGACATCCCAACAGAAGCATCAAACCCAAAAGCTTTACAATTGGTAAAAAAATTGTAATGGTCAGTGATCTGCCAGAATTTTTAGATGAATCCTTCATGTACAAAAAAATAGTTTAGCTTAAAATNNNNNNNNNNTTCCATGGAACTTAAATTTCATAACAGGGACATGTGCACCAGGTACAGGTTGCAGTTCAGTCACTTCTTCAGTTTGGGCTAATATGCCACGTAGTACAATAAAGAAATCTTCCTGCATAAAGAAT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001118 Download
Protein sequence
Protein sequence
MKSLVAPPGTMIRGGGEELWSADLSKLETGRKFASGRHSRVYFDRYGRREVAIKMNFRTTLRCLKYWAKRRGVYSNVTGFLGGVNWALLVARVCQLYPNAVPSMLVSRFFRVFTQWCWPNPVMLCAIEEDELGFPVWDRRKNPRDRSHHMPIITPAYPCMNSSYNVSTSTLRVMIEQFQFGNKICQVIFFATTEATIAEIELNKANWSALFKPFQFFEAYKNYLQVDIIAEDDEDLRLWKGWIESRLRQLTLKIERDTYGMLQCHPYPHEYADPSRQCAHCAFFMGLSRKEGVKIQEGQQFDIRGTVDEFRHQINMYIFWKPGMELAVSHVRRKQIPSYVFPEGYKRPRPSRHANHQQQSDKNDIENGTMTGSPDGQVKRKLDSAGSDDTEPCRSVKRASVSPVPPKTSSPQSGNVGDETNQTEMASSVSGGSQTSLGTGNLEKANCSSSPQASEKSLDSVASGSKCATGGEVCSGDTTSKHGNCVSHVKKCTSPTVAVCTTLKRVAEKVVSELVGSESLGNSNSAELLERADKDMGNVLVENVHFDGNGVASSGLPEELEVLLLVHSLLF
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above