gene PH01001035G0130
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01001035:105886 - 107343(+ stand)   Name
Alternate name Locus tag PH01001035G0130
Length of gene 1458  bp Length of CDS 693  bp
Product information
Feature type
CDS
Product name
thaumatin
Alternate name
Molecular weight
(predicted)
23392.2446199999  kDa
Isoeletric point
(predicted)
5.52522659301757
Length
230  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP05236780 PH01001035:105926 A A_G
PH01SNP05236790 PH01001035:105939 T T_A
PH01SNP05236800 PH01001035:106022 T T_C
PH01SNP05236810 PH01001035:106086 C C_T
PH01SNP05236820 PH01001035:106169 G G_T
PH01SNP05236830 PH01001035:106181 T T_C
PH01SNP05236840 PH01001035:106219 T T_C
PH01SNP05236850 PH01001035:106396 G G_T
PH01SNP05236860 PH01001035:106408 T T_G
PH01SNP05236870 PH01001035:106476 G G_C
PH01SNP05236880 PH01001035:106548 T T_C
PH01SNP05236890 PH01001035:106605 A A_G
PH01SNP05236900 PH01001035:106674 C C_T
PH01SNP05236910 PH01001035:106765 C C_T
PH01SNP05236920 PH01001035:106814 G G_A
PH01SNP05236930 PH01001035:106834 G G_A
PH01SNP05236940 PH01001035:106995 C C_T
PH01SNP05236950 PH01001035:107107 A A_T
PH01SNP05236960 PH01001035:107181 G G_T
Ortholog Groups (determined by OrthoMCL algorithm)
(0 result)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT4G36010.2
Pathogenesis-related thaumatin superfamily protein
Pathogenesis-related thaumatin superfamily protein; CONTAINS InterPro DOMAIN/s: Thaumatin, pathogenesis-related (InterPro:IPR001938); BEST Arabidopsis thaliana protein match is: Pathogenesis-related thaumatin superfamily protein (TAIR:AT2G17860.1); Has 35
4E-44
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os10g05660.1 thaumatin, putative, expressed 2E-48
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
    1. SSF49870 (Osmotin, ...)
    2. PR00347 (THAUMATIN)
    3. PS51367 (THAUMATIN_2)
    4. PF00314 (Thaumatin)
    5. SM00205 (THN)
    1. PS00316 (THAUMATIN_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31048 (FAMILY N...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 185757 40 227 8.44E-62 cd09218 TLP-PA cl02511 -
superfamily 243063 40 227 8.44E-62 cl02511 GH64-TLP-SF superfamily - -
non-specific 215853 45 228 1.62E-52 pfam00314 Thaumatin cl02511 -
non-specific 128501 41 228 3.63E-43 smart00205 THN cl02511 -
non-specific 185754 41 227 1.97E-18 cd09215 Thaumatin-like cl02511 -
non-specific 185752 41 195 4.82E-15 cd08961 GH64-TLP-SF cl02511 -
non-specific 185756 41 228 6.63E-14 cd09217 TLP-P cl02511 -
non-specific 185758 41 228 1.09E-13 cd09219 TLP-F cl02511 -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01001035G0130 gene.
TGACAGTAGCTGCCAACATAAAAAAAATTGTCATGAACCATTTGCAAACATTTCATTCAAATACAATCATGAGCAAAGGGCATTTGAACACAATAATCCATTCAATCAGTTTATTCAACCACAATGCATATGTAAAATACAAACACAACCATCTATTCATCTCATTTCATTGTACCAAAAGAAATTCATCTCATTTCATTCAAGAAATGCGCCATACATCCATTCACTTGCGCTTTCGGCGCGCACCTGACCCTGGTGTGAATCTCGCTACTGGGTGTTGGCCTCGCGTGCCCTCGACGACGTTGACCGAACTAATGTTCGCGCGATCACTCCGTTTACGGCGCGGAAGCGTGGCTTGAGTCGGCTGCGTAGGGGACGGTACACCAACAAGGTCCCGAAGCATCATCTCGTCCGGATGTCAGACTAATTTCAATCCTTTGGGAATTTGAACCGGGAGGTCCAATTTCACGTGCCAAGTTTAATTCTGGGACCCAAACGCGAACCTTGGTGTGTTTGATTTGAGGATCACCTCATCCAAGAGTCAAAGAGATCAGGTTGACCTGTCGCTTTTGTCAGTTGACCTGTCGCTTGACTCCTGCAGAGCCATGAACGATGCAGACTATCTTATTTCTTCATTTCAAGAGTACCAAACCTGCACCAAACCGAAAAGGAAACGAAAAAAAAAAGTAGCAGAACTACCAATCGATCGGTGAAATTAATTGATGAACAGTTTGATTGCTGGTACTAGCACACTACGTGATGCTAATTACTTAACTTGCCTTTGTTTTGTCAGTACGCTGTAGTAAAAGTAGCCAGCTAACCCATGCCAAGCGTGAGCCACCAAATAAATTGGCTAAAAAAGAAGCTTTTTTTGCTTTTCTTTTGTCAGTATGCTGTAGTAAAACTAGCTAGCCCATGCCAAGCGTGAGCGACCAAATAAATTCGCTAAAAAAGAAGCTTTTTTGTTGCCTTCTCTCCACGTATCATCTATATCCGCCATG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGGTAGCTCACCTTCTTCTCCAACCCTTCATGGCTGGCAATGGAGCTAGGGTGATTCCGGCCATTCTCCTTGTCCAGCTCCTCCTCAGAGCGCTTGTCGCGGAGGGCGCGTCGTCCTTCAGCTTCACCAACGGCTGCCAGTACCCGGTGTGGGTGGGCGCGCTCAACGGCTCCAGCTCGCCGCGGCTCGCGCGCTCCGGCTTCTACCTCCCGCCGACCGCCACCTCCCACCTCGCCGCGCCGTCGTCCGGCAGCTGGTCCGGCACATTCTGGGCGCGCACCGGCTGCGCGACCGACTCCACCACCGGCCGTTTCTCCTGCGCCACCGCCGACTGCGGCTCGGGCGACGTCACCTGCGACGGCCGCGGACCGTCGACCCCGGTCACGCTCGTCGAGGTAACCCTCGCCGCCGCCGGCTCCGGCGGCCAGGACTTCTACGACCTGCGCGTCCTGGCCGCGTCCGGCGGTGGCGTCGTGGCGTGCCGGAGCGCCTGCAACGTGTACGGCAGCGCGCGCTACTGCTGCACCGGCGAGTACGGCACGCCGGCGGCGTGCGGGCCTACCGACTACTCGCAGGTGTTCAAGAGCGCGTGCCCGGCGGCGTACAGCTACGCCTACGACGACGCCAGCAGCACCTTCACCTGCTCCGGGGCCTCCAGCTATGACGTCACCTTCTGCCCTGGGACTTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01001035G0130 gene.
AAAAAAGAGCCCCTACGGTCAGGGTGGAGCTGGCCACAGGCCAATCCTCTAGCCGGTCCAGCTGCTTTTGGTCTAAAGTTGTATTTTACTAATTTTTCAATGATTTTTTTATTGGCAGTTGATTTTGGGCCTCGCCATTGTCCTAAAGGACCGAGGCCCAGCTCCGCTCTTGCTACAGTGATATCATGACATGCATATTTGTATTTATTCATTAATTTGTTTTGTTCCTGTGGCATCTTAGATGATGCTACAATATATATATACTAGTAAAGATCATGCGTGTAATTAAATGAAACAGCCTAAAATACTACACCATAAAAAATCATGCATCGAGAAGATAGTATCCTAACACTCCTCATGCACTAAAGAAACTGCACTAAGATACTGTCCATCGGGAGCAGTCTTATTTGATATACACTAGCCAAGCGTTCACGCAGCCCCATATTCTTCATTTATTTACTTGGATGCTAAGAGAGAAAATAAATTCTACGGGGCCTCGGGAGAGACCCTTCCTTCTCCTTCACATATCACACCCCTCCGCGCAGTCCAACGGCCCGGGGAGGAGCCTTGCAGTGAGCCCCTCCTTCAAAGAATTCATTTCCCTAAAAGGACTTGTTCGCGACTGGCACCAACGCCAAGGTTCAACGAACACCACTGTTGTTCGTCTGGCCACAGTGAATCGACCTTTGGCGGCCTGGTATGCGGACTGCCTGACTAAAGCATCTGATTGATGAATTCACCTGAAACAGTTCATATGAATCCACAACTTTGGATTGACTATTCATTGGTTTTATGAGATCGAAACCCTGAACTATGAAGTACATCTCTCATACAAATCAGTGGTTTATTCCAGGAAGAAAATCGCAAGAAAATTGCACTAGTCAACTTGGTTCTAAAATTCACTCCCCAAGGATTAAAGTCAAGCACTGAACAATAAATATAATGCTAACTGAACAGTACTGTAACAACAGCATGTTGTTGAGCAGAGGACCTACGGTGCA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01001035 Download
Protein sequence
Protein sequence
MAVAHLLLQPFMAGNGARVIPAILLVQLLLRALVAEGASSFSFTNGCQYPVWVGALNGSSSPRLARSGFYLPPTATSHLAAPSSGSWSGTFWARTGCATDSTTGRFSCATADCGSGDVTCDGRGPSTPVTLVEVTLAAAGSGGQDFYDLRVLAASGGGVVACRSACNVYGSARYCCTGEYGTPAACGPTDYSQVFKSACPAAYSYAYDDASSTFTCSGASSYDVTFCPGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above