gene PH01000988G0460
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000988:294483 - 313401(+ stand)   Name
Alternate name Locus tag PH01000988G0460
Length of gene 18919  bp Length of CDS 1041  bp
Product information
Feature type
CDS
Product name
mitotic checkpoint protein
Alternate name
Molecular weight
(predicted)
37866.55072  kDa
Isoeletric point
(predicted)
8.0406379699707
Length
347  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP05063600 PH01000988:298611 G G_A
PH01SNP05063610 PH01000988:302538 G G_A
PH01SNP05063620 PH01000988:303250 T T_C
PH01SNP05063630 PH01000988:303829 G G_A
PH01SNP05063640 PH01000988:303858 T T_C
PH01SNP05063650 PH01000988:303879 T T_A
PH01SNP05063660 PH01000988:305933 C C_T
PH01SNP05063670 PH01000988:305963 C C_A
PH01SNP05063680 PH01000988:305991 G G_A
PH01SNP05063690 PH01000988:307419 G G_A
PH01SNP05063700 PH01000988:308506 G G_C
PH01SNP05063710 PH01000988:308534 C C_T
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_129740 1
Please click OG5_129740 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT3G19590.1
Transducin/WD40 repeat-like superfamily protein
Encodes a protein that may have a role in the spindle assembly checkpoint.
BUB (BUDDING UNINHIBITED BY BENZYMIDAZOL) 3.1 (BUB3.1); CONTAINS InterPro DOMAIN/s: WD40 repeat 2 (InterPro:IPR019782), WD40 repeat-like-containing domain (InterPro:IPR011046), WD40-repeat-containing domain (InterPro:IPR017986), WD40/YVTN repeat-like-con
0
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os03g33580.1 mitotic checkpoint protein, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Repeat
  3. Repeat
1 50 100 150 200 250 300 347
Detailed signature matches
    1. SSF50978 (WD40 repe...)
    2. PS50294 (WD_REPEATS...)
    1. PS50082 (WD_REPEATS_2)
    2. SM00320 (WD40)
    3. PF00400 (WD40)
    1. PR00320 (GPROTEINBRPT)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR10971 (MRNA EXP...)
  2. PTHR10971:SF5 (MITO...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
KEGG orthology Functional Subsystem Pathway
Cellular Processes Cell growth and death Cell cycle  
Cellular Processes Cell growth and death Cell cycle - yeast  
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
ID for KEGG orthology Reaction description EC number
K02180 cell cycle arrest protein BUB3
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 238121 25 311 1.84E-29 cd00200 WD40 cl02567 -
superfamily 243092 25 311 1.84E-29 cl02567 WD40 superfamily - -
non-specific 238121 25 277 3.52E-24 cd00200 WD40 cl02567 -
non-specific 238121 58 310 8.72E-22 cd00200 WD40 cl02567 -
non-specific 201208 101 134 4.08E-05 pfam00400 WD40 cl02567 -
non-specific 197651 101 134 5.56E-05 smart00320 WD40 cl02567 -
non-specific 201208 251 277 0.000677519 pfam00400 WD40 cl02567 N
non-specific 197651 251 277 0.00131521 smart00320 WD40 cl02567 N
non-specific 201208 25 53 0.00246396 pfam00400 WD40 cl02567 N
non-specific 197651 25 53 0.00389894 smart00320 WD40 cl02567 N
multi-dom 225201 22 311 7.70E-20 COG2319 COG2319 - N
multi-dom 225201 25 312 2.08E-19 COG2319 COG2319 - C
multi-dom 225201 22 301 2.53E-16 COG2319 COG2319 - N
multi-dom 225201 102 345 1.76E-12 COG2319 COG2319 - C
multi-dom 173611 252 310 0.00354562 PTZ00421 PTZ00421 - NC
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic structural tetrad V42,D46,Y52,D53,H65,S82,D86,F94,S95,H105,T123,D127,W133,D134,Y149,A168,Y177,D178,S192,L193,L211,E215,F223,D224,C238,H239,A265,D270,W276,D277,K289,Y290,V308 40 33 238121
 
DNA sequence
Upstream 1000 bp region from PH01000988G0460 gene.
GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGCATAGGGCAGTCGTCGGGCGGACGGCGCAGAAACGCGTAGTCAGGGGCGGTGAGCTCAAGCCTTGGGCTGTCGGGGGTGCAAGGCTGCCGGCGGCCACTAAATGGTGTAGGTTGGAAGGCGGTGGGAGGAGCTCGAGCCAGCCTCGGTGACTCCTAGTCGCCTAGCCCCTCGACATCGAGTTCTCAATGCGTGCGTGCACCGTGGGTACGACGAGAAAGAATAGAGACCAGAGGTGTGCGCTTGGGTTAGACTACGGGATGGGCCGGACTACGGGTAGGATGGGCTGGGCTGCTTTAGAAGGGGTTACATTATTTTCGGTTTTTACGATTTGTTTGGTTTTCCCTTTGAAAATGAGATCTCTTTATATCGTACCTAATTCATGTAGCTCAAACCAAGTTGATACGGTTCAGTATTTTTGGTTCCGTGTCAACATAAACTGCCATAGCCATAACACACACATTTGCCACGTGTCCTCGTGGCTAGCACCACAGCCTCAATAATTGGGGGAGGAGATGGATTTTTTTTTTGTCGTGCTTTAATATATTTTGTGATTTACTCCAATGGCTAGGCTCCTGTGTGGCAGATCCGATGGATGTGTAGATTTTTGGGGAGATTTCAGTGATATTTTGTGGCCAAACTGTGCATCCACAAATATGTAAGACTTGTGAAATCTTCGGTAGTCATTTAAGCACCACATATGACAAAACCACCTAGAAAGTCAAGGTCTAGGATAACCATTTTTTTTTACTTCGAGGGTCAAGTGGCTACAACATAAAAGTTCAGGGCTAAAATACAGTGCCCATCCATTCGATGGCCCGGGCCAGCCCACTAACGACGCCTCGCCTCAGCCCGCACCGGAGGTACACGGAAATCACCATGGAATCTTCTCGCGTTCTCTCTCTCCTCCTCCCCGTTGCTCCCGTCCGTCGAGTCCGAATTCTCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGAGCTCCGCCGCCGCCGCACCAGCCAGCGCTGCCGCCGTGGGCAGCGGCAAGGAGCTCGCGAACCCGCCGTCCGACGGCATCTCCAACCTCCGCTTCTCCAACCACAGCGACCACCTCCTCGTCTCCTCCTGGGACAAGACGGTGCGGCTCTACGACGCCGACGCGAACGTGCTCAAGGGGGAGTTCGTGCACCCCGGGGCTGTACTCGACTGCTGCTTCCACGACGACTCCTCGGGGTTTAGCGCCGGCGCCGACCACACCGTGCGGAGGTTAGTATTTAGTTCGGCAAAAGAGGATGTTCTGGGGCGGCATGATGCTCCAGTTCGCTGCGTGGAGTACTCCTATGCTGCAGGTCAAGTCATCACTGGCAGCTGGGATAAGACTATTAAATGTTGGGATCCAAGAGGCGTGAGCGGGCCAGAGCGTACACTTGTTGGGACATATACTCAACCTGAGCGTGTATATTCTCTGTCATTAGTAGGAAATAGGTTGGTTGTTGCAACGGCAGGAAGGCATGTCAATATTTATGATCTGCGCAATATGTCTCAACCTGAGCAAAAAAGGGATTCGTCTTTGAAATATCAAACACGTTGTGTTCGATGTTTCCCCAACGGAACAGGATATGCTCTAAGTTCTGTTGAAGGACGAGTTTCTATGGAATTCTTTGATCTATCCGAGTCTGCTCAAACCAAAAAGTATGCTTTCAAGTGTCATCGGAAATCTGAGGCTGGCAGAGACACCGTTTATCCTGTCAATGCAATTGCATTCCATCCAATATATGGCACATTTGCCACTGGAGGGTGTGATGGATTTGTGAATGTATGGGATGGCATTAACAAGAAAAGACTATATCAGTACTCAAAGTACGCATCAAGCATCGCTGCTCTGTCATTCAGTAAGGATGGGCATCTGCTTGCTGTGGCATCAAGCTACACTTACGAAGAGGGAGAAAAACCCCATGAGCCTGATGCAATATTTATCCGGGCGGTGAATGAAGTGGAGGTAAAGCCGAAGCCTAAGGCATTGGCCGCTCCCCAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000988G0460 gene.
AGACCTACCAAAAGTTGTAACAGACCCGAGTACTGGGTAACTGTTGATTAGCTGAATTTGATTAGTTTTTGTCAACAAAAAAATACAAGTTTTTTACTTGTCATTTTTAAAAACCTGTTTACTTGTCATCTGAGATGGCTATTTCATAATTGAGCGAAACTCATAATTTTCTACAAGAAGTAGATCCAACTGGCCGGATGCGGCAAGCCGCATCCCAATTGGCTAAACATCTTAGCCTGGAATCATATCATCATTACGCTTGCCCTGCCTTTAGTTCAATTTTAGCCCTTCTTTTCCAATGAATAACACCGATGCAAGTGTACCTGCAGAAAGTTGCCGCTTGGTTCTCTACTCTCGCCAAACAGTAAGCAAATGAAAAAACAAACAAAGGGTTTTGATAGCTCTCAGCCAACTGTTTTGTAGATAAAAATCAGCTAAATTTTGGAGCGGTGGATCGTCCTTGCGTTTTGTTTCTCTGATTGGATCAAACGGGCTCTTGCGGGAGTAACGAACGCTATTTTGGACTCGGATCCGTTTGGGTTTGTGAGTTGTGACTCGTCAGTTACTTTCTTGGACGCAATTCACTTGTCTTCTCAGACCATGCGTTTATGAGAGAGCGCAGAGAGATGGATACGCAGACGAAGTAGGAGTAAAACCGCGGCGATATCGACCCTGCCGGCGCTTAATTGGACCGGGGTTGGCGACGAGGTGAGGAGTAATCGCCGGCGATGTAGTAAGGAAATCGCCACCCCGAGTCCCGACTCACATTCCCGGCGCATAGGTGAGTTTTTACCTTGTCTAACCGCGTCACGTCGTGTTCTCAAGGCCCAGTAGCATTTCCCTTTATTCAGTTTCACCTTTTTCGCAGATGTTCGCTGGAGTCGAGTCGTCTTCTTCGCCTCCGGCCAAGCTGCCGACATCATGGAATTCGTCGCCCTCGGTAAGTTTCTTCTCAATTCCTCTCGGCCGTAGCGCCACCTTATGATAATTGCTTAGTCACA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000988 Download
Protein sequence
Protein sequence
MSSAAAAPASAAAVGSGKELANPPSDGISNLRFSNHSDHLLVSSWDKTVRLYDADANVLKGEFVHPGAVLDCCFHDDSSGFSAGADHTVRRLVFSSAKEDVLGRHDAPVRCVEYSYAAGQVITGSWDKTIKCWDPRGVSGPERTLVGTYTQPERVYSLSLVGNRLVVATAGRHVNIYDLRNMSQPEQKRDSSLKYQTRCVRCFPNGTGYALSSVEGRVSMEFFDLSESAQTKKYAFKCHRKSEAGRDTVYPVNAIAFHPIYGTFATGGCDGFVNVWDGINKKRLYQYSKYASSIAALSFSKDGHLLAVASSYTYEEGEKPHEPDAIFIRAVNEVEVKPKPKALAAPQ
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above