gene PH01000948G0320
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000948:198456 - 204246(- stand)   Name
Alternate name Locus tag PH01000948G0320
Length of gene 5791  bp Length of CDS 1410  bp
Product information
Feature type
CDS
Product name
AP2 domain containing protein
Alternate name
Molecular weight
(predicted)
51143.0928200001  kDa
Isoeletric point
(predicted)
7.66663742065429
Length
469  aa
Expression profiles
Expression status (Yes/No)
No
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP04914930 PH01000948:199248 T T_C
PH01SNP04914940 PH01000948:199369 T T_C
PH01SNP04914950 PH01000948:200519 T T_C
PH01SNP04914960 PH01000948:200556 C C_T
PH01SNP04914970 PH01000948:200566 C C_T
PH01SNP04914980 PH01000948:200595 C C_T
PH01SNP04914990 PH01000948:200695 A A_G
PH01SNP04915000 PH01000948:200705 G G_A
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_170666 2
Please click OG5_170666 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os06g43220.1 AP2 domain containing protein, expressed 1E-131
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 300 350 400 469
Detailed signature matches
    1. SSF54171 (DNA-bindi...)
    1. PF00847 (AP2)
    2. SM00380 (AP2)
    3. PS51032 (AP2_ERF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR32467 (FAMILY N...)
  2. PTHR32467:SF0 (SUBF...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0003677 DNA binding
GO:0003700 sequence-specific DNA binding transcription factor activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 237985 198 258 3.55E-20 cd00018 AP2 cl00033 -
superfamily 241562 198 258 3.55E-20 cl00033 AP2 superfamily - -
non-specific 197689 199 262 7.20E-24 smart00380 AP2 cl00033 -
non-specific 197689 113 169 7.72E-08 smart00380 AP2 cl00033 -
superfamily 241562 113 169 7.72E-08 cl00033 AP2 superfamily - -
non-specific 216148 198 248 3.70E-07 pfam00847 AP2 cl00033 -
non-specific 237985 113 162 0.000122237 cd00018 AP2 cl00033 -
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site R201,G202,T204,H206,C208,K210,R214,G216,Y223,Y225,L228 11 11 237985
generic DNA binding site R115,G116,T118,R121,T123,R125,Q130,Y132,G135 11 9 237985
 
DNA sequence
Upstream 1000 bp region from PH01000948G0320 gene.
TTCTTCGGGCGGTCAGACCAGCGTTCATTGAGCGGTCAGACCGGGGTGCGGTCTGACCGGCAGCAAAGGAGCGGTCTAACCGGACCTGACGATGAACAGGAAAAACAGCTCAGGATCTAAAACAAAAATCGATCAAACTTTTGATCGACATGGCCAAAGTTAACCAAACTTGGAACACACCTTCCCAAGGATATCTGGAACCTATTCCAAGCGACGATCGAGTAGATCCAGGTCAAAGTTTTGACCTTTTTCCATTTTACCGAAAGAGGGTTGAAAACCGAGCAAAAATGAAAAACTTGATCCAAAACTTGCTCGTGGGAGATTGATGATCCTAGATGTATTCCCACATGTCACAGTAAGGTAGATGGGGGCAAGAAACCACTAGAAACCCATTGGATCAAAGAAGCACCCAAAATCACTAAATAAAAAGGAAGAACACAAGAAGACTCATCTTTGAAAAATCATCCATAGATTGATTCGCGATTGTTGCTGGTTACAACCACTCCCTCAAGGAGGACAAGAACTCAATCCATGAGCACTAAATCAAATCAATTCTCTAAAACCCTAAACCTCTCCTTTCCTCTTTAAGCCCTAAGACAAACTATGGTTTTGCAAATAAAGTGCTTGGGGGCTGTTTGACAGCACCCCCTCCTATTTATAGTGAGGCTTAGCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACCGCTTCTCCACGCACCGTCTTGCGCCGCGGTTTAGCCCAAGGTCACAGAGGCGGTATTTGGTCAAATTACCAAAATACCCCTTCTTGATCTTTCTCCAAAGACCAAGTCCGATCTTGGTGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCAAGCAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGGCCACCAAGAGAGCCTTCTACGGCGCCGGCGGCATTGCACTCGCCATGCACAGAGACGACGCCGTGGTCGACGAGGCGGAGTTGGGGGGCCAGACGGAGGAAGGTTCTAGAAGGATCTTTGGGCTCCCTGTGCCCGCCGGGGGGCCTGCCACCCGGCCGATCGTTACCCAGCAGTTCTTTCCGACGACGGTGGTGGCAGCGACGGTTGTGGCGCCGGCGGCAACGCAGCAGCAGGCAATGGAGCAGTGCCACCTGGCTGCCACGGTGGCTGACCAGTGGGCCCGGCCGCCTTCGAGGAAGAGCCGGCGGGGGCCACGGTCGAGGAGCTCGCAGTACCGCGGCGTCACCTTCTACCGGCGCACCGGCCGGGATTGTGGAAAGCAAGTGTACTTGGGTGGATTTGATACAGCACAGGCTGCTGCAAGGGCCTATGACCAAGCTGCAATCAAGTTCCGTGGTGTGGACGCAGACATCAACTTCACCCTGGATGACTACAAGGAGGACATAAACAAGATGAATAGCTTCAGCAAGGAGGAGTTCATCCAGGTTCTCCGGCGACAGGGCGCCGGCTTCGTCAGGGGGAGCTCGAGATTCCGGGGGGTCACCCTTCACAAGTGCGGCAAATGGGAGGCCAGGACCGGCCAGCTCATGGGCAAGAAATATGTGTACCTTGGCCTGTATGACACAGAGATGGAGGCTGCCAAGGCTTATGACAAGGCTGTGATCAAGTGCTATGGCAAGGAGGCGGTGACCAACTTCGACCCGCAGACGTACGAGAATGAGCTGAGCCTGCAACCTTGGGACAGTGAGCTTGATCTTGAGCTCAGCCTGGGCTGCTCGGGTGGCGAAAGGGCCGGCGATCCTACCACCGTCAGCGACGACATCTTCCACGGCGCACCGAGCAACCAGAGAACGAGGCTGACGTTCAAGATGCCCGAGGAGGAGGAAGACACAAGGGCCTGCTACCCTCCGAGGAGCAACTGGACCAGGCCTTCGTCGACTCCGATATGGCCGAACGACGCGTTCAGGCGCCCAGATGATGATCACCACCCCGGTAGCAGGAACATGCTTCACATGCTCCAGATGGACCAGGTCAGCAGCAGTGGAGTCTGGGAGGGAGCAACAGCAGCAGGAGCAGGGGTGAGCGCTGCAGAGCTACACATGCGCCCGCGCCCCGGCTGGCCCAACGGCGGCAATAATTGGCGGCCGTACGCCGCCCAGTCCCGGCTGCCCGTGCCCGACGACGACGCCTACACCGCTGCAGCATCATCAGGATTCCCCACTGGGGCTAGGCAGCTGCTGGGCGCAGCAGCAGCAGGCGGCTACGGCGTCAAGGCCCAGCAGCTGAACCACCACCCAGCACCCAACAGCAGTGGCACACTGGCACTGATCAGTGATCACTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000948G0320 gene.
GGGCTTCTCACCTAACCATCATCCCTCCTTTTTATGTCTCTTCATGGGTGCACATTTACTGATCTGCCCACAAGATCACAATCACATACAGCGTTGTTGTATATGACTATATCTACCTATCTGCCATTTGTTCTATATAGGCATATTTGAAACACAGGAATTTTTACACCCGCCAGATTTCTAGTAAACTCTTGTGTTCCAAATGGGCCAAAAGTAATTATGTTTCTACTTCATATTACAACAGTTTTATATCTATTCTTAGAAGTTTACATATTAGCACTGTTTTTTTTTAAACAAGATATTAGCACCAGGGTTCAGATCGGCCGATTTTCGGTTGTATTGGTATGTGCCAGTAGAAGTTCAAACCGGCTCCAAAAATCTCGGTTCGGATGATTTTGTCAAAAAAAAAAAATCAAATTTGCTTGAATTTTGCCCGAATTTGATTTTTTAAAAAAATTTAAAATCCGAAAAATTCAGTTTTTTTTTTTAAAAAATTTCGGCCGAATTTGGCCGAAATTTTCTGATTTTCGGTTGTATCAGAAAAAAAATTTCGGCCGAATTTGGCCGAAATTTTCTGATTTTCGGTTGTATCAGCCTTACTGGTCACCCCTGGTAAAAATTAACTTCCAATTAAAAAAACCCCTGATTAGCACTCAGTTTCTTCCATAGATACTCAAACAATCAAACTAGTGCAGTATCCAAGCATGTGTAGGGAGTAGATATTCAAATTAACTCGTAGGTTTCTTGCATTCGGCCAACACTACTGCCTGCCTCATTTAGGTGCAAGCTAGCCTAGCCATTGTCTTCATTCACTTGGCTGCATAAAAGGCCCCACCGTCCACCTCCGCTTGCTTGCGCCGGTGAAAGAGGTTTTAATACGGAAGCAAAGTCATGTGTCGCCTCTGCTCTGCGTGTGCAAGAGAGGAGATCGATGAGGCATCATGTACTCCCGGCTCCCCATCCCACGTTAACCAGATCGAAAACATCATGATGCATCATAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000948 Download
Protein sequence
Protein sequence
MAATKRAFYGAGGIALAMHRDDAVVDEAELGGQTEEGSRRIFGLPVPAGGPATRPIVTQQFFPTTVVAATVVAPAATQQQAMEQCHLAATVADQWARPPSRKSRRGPRSRSSQYRGVTFYRRTGRDCGKQVYLGGFDTAQAAARAYDQAAIKFRGVDADINFTLDDYKEDINKMNSFSKEEFIQVLRRQGAGFVRGSSRFRGVTLHKCGKWEARTGQLMGKKYVYLGLYDTEMEAAKAYDKAVIKCYGKEAVTNFDPQTYENELSLQPWDSELDLELSLGCSGGERAGDPTTVSDDIFHGAPSNQRTRLTFKMPEEEEDTRACYPPRSNWTRPSSTPIWPNDAFRRPDDDHHPGSRNMLHMLQMDQVSSSGVWEGATAAGAGVSAAELHMRPRPGWPNGGNNWRPYAAQSRLPVPDDDAYTAAASSGFPTGARQLLGAAAAGGYGVKAQQLNHHPAPNSSGTLALISDH
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above