gene PH01000943G0260
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000943:138398 - 139352(+ stand)   Name
Alternate name Locus tag PH01000943G0260
Length of gene 955  bp Length of CDS 642  bp
Product information
Feature type
CDS
Product name
heat shock 22 kDa protein, mitochondrial precursor
Alternate name
HSP20
Molecular weight
(predicted)
23706.93422  kDa
Isoeletric point
(predicted)
7.81435775756835
Length
213  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_170639 1
Please click OG5_170639 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT4G25200.1
mitochondrion-localized small heat shock protein 23.6
AtHSP23.6-mito mRNA, nuclear gene encoding mitochondrial
mitochondrion-localized small heat shock protein 23.6 (HSP23.6-MITO); FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to cadmium ion, response to heat; EXPRESSED IN: 6 plant structures; EXPRESSED DURING: 4 anthesis, petal differentiation a
2E-23
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os02g52150.2 heat shock 22 kDa protein, mitochondrial precursor, putative, expressed 1E-76
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 20 40 60 80 100 120 140 160 180 200 213
Detailed signature matches
    1. SSF49764 (HSP20-lik...)
    1. PS01031 (HSP20)
    2. PF00011 (HSP20)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR11527 (SMALL HE...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
KEGG orthology Functional Subsystem Pathway
Genetic Information Processing Folding, sorting and degradation Protein processing in endoplasmic reticulum  
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
ID for KEGG orthology Reaction description EC number
K13993 HSP20 family protein
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 107221 118 190 9.69E-09 cd06464 ACD_sHsps-like cl00175 -
superfamily 241659 118 190 9.69E-09 cl00175 alpha-crystallin-Hsps_p23-like superfamily - -
non-specific 107219 118 190 3.07E-07 cd00298 ACD_sHsps_p23-like cl00175 -
non-specific 215655 118 190 3.25E-06 pfam00011 HSP20 cl00175 C
non-specific 107229 118 190 0.000371429 cd06472 ACD_ScHsp26_like cl00175 -
multi-dom 223149 116 190 0.000199778 COG0071 IbpA - N
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific putative dimer interface K118,E119,E120,R127,D129,P131,G132,G169,G190 12 9 107221
 
DNA sequence
Upstream 1000 bp region from PH01000943G0260 gene.
GTATGTGAAAGACATGATTCACCCGATTTACTTTACCTACTCTAAACTACAGATTGAGGCATAGATAATAGAATAACAAACATGCCAACTGAGCAGATCCACGATAGTTGCAAGTTTCCAATCTACCGAGTTAATCTAACCAAATCAATCTGGTCAAATTTACAGGCACTGATCTTTATTGATCGAATAGCCTCGTGCTACTCTATGCACAGATCCTCACAAGATTTAGCGACAATAGATCGAACGCGACCAATCTAAACAAAGTAGCGGTAAATCGCATCAAGAAAAGCATAAGCATCCAAAGTTAGGTAGGCAGTGAGCGCATCGGGAAGACTGAAAACCTTGCATCTCCTTGGCGACCTTGGCCTGCATGTCGCGGAGGGCGGCGGCCTCCTCCTCCATCTCCTTCAGCCTGCGCTTCATCTCGTCGAGCTCCTGCAGCTGCGAGAACCAACAGGGTCAGGGACTCAGACCTAGGGTTAGGGTTTAGCGCGGAGACAGGGGGATCAAGGGGTTTACCTTTGCCGCGTCGTCTCCGCCGGAGGTCATGTCGACTTCGGCGCCGTCCATGTCGCCGTCCACCGGGATCTCCTGGCCGTACACCTCGTGCTCCTCCTCGTCCATGGCGGTGCGGTGCGGTGCGGTGCGTGGTCTCTTCGATGATTCGATCCAATCCGGTTTGGTCGCCGTGGTGCGAGGTTTGGTAACGGGGTGGGTGGGTCCAAGCTGGGCTAGATTTTTTATTGGACTTATGGGCCTCGGCTCATGTGAGGCTTTGTTGACACAGACTGGGCTGGATGTTTCGTTGGGCCTGTGGATTTCGGGCCATCCGATTCGACTGCACGTGTATGTATCGCTCGTATTCGTGCGGTCCACGAGAAGACCTGGTGGTGGGTCCGCCCCATCGGAAAACTAAAATCTGCATTCCCGCGCCTTCTGGAATGTTCCGGCTGCAGGGGCGCCTTCCCGAACGTTCTAAATTCTTCCGCAAGCTCCGCCGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCTTCTATTGTGGCTTCCAAGAGGATCCCGCTGGTGCGCGCTGCGGAGAAGCTCCTGGCCGCGTCGTCTGCCCCCGATGTCTCCGCTGCTCTCAGGTCGGTGGCCGTCGCCGGCGGCGTCCGCGGCTACAACAGCAGCGCGCCGCTCCGCAGCTACGAGTCGGACGACGACAGCGGGCGCGAGTACGACGACCGCCGCCGCGCGCGCGACATCGCCGTGCCCAGCTTCTTCTCAGATGTGTTTCGTGATCCGTTCAGTGCGCCGCAGAGCCTCGACCGCCTGCTGCGTCTGATGGACGACTTGGCGGCGCCCAGCCGTGCCGCTCCGCTGCGCCGCGGGTGGAACGCGAAGGAGGAGGACGAGGCGCTCCACCTGAGGGTGGACATGCCGGGCCTGGGGAAGGAGCACGTCAAGGTGTGGGCCGAGCAGAACTGCCTGGTCATCAAGGGCGAGGGCGAGAAGGACTCCGAGGAGGAGGGGGCTGCAACCCCGAGGTACAGCGGCCGCATCGAGCTCGCGCCGGAGGTGTACAGGATGGACAAGATCAAGGCCGAGATGAAGAACGGCGTGCTCAGGGTGGTCGTACCCAAGGTCAAGGAGGAGCGGCGCAGGGACGTCTTCCGGGTCAACGTCGAGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000943G0260 gene.
AATAAGCAGTGAAGCGTGGTGTGTCAGATAATTTTTCTCTTTTTTCAGTTTTGCTAGTTTGTTGATCTGGTACTACTATATTTCGTTCGTATTGCACCAACGCAACGGGCAAAGGTAATCCGACCCTATCTCAAGTTCCGGCGTCCGTATCAAACACGTAATCAAACTAGTCTCGCTACTTCCGCGCGGCACAAATAGACGAACCGAGCGCGCACACGGGCACGAAGGCTCCGCGCAGATCACAAGAACTACCTCCTTGTTCCGGCGCCGCTGGCCGAGCCGAGCAAGACGCCCGCCATGGCACAACCGCCGGAGAGGTATCCAGTGGAGGAAGCCAAAGCCGCCGTCTCCTTCCTGAGAGATGCCAGGGCCCGCTTCGCGTCGTATCCGTCCGTCCACACGGAGTTCTACGCCCTCCTCACGGCCTTCGGAAAGGGCGAGATCGCCGACGTCCGCGCCGTCGTGACCCGCGCGGAGGCGCTCCTCCAGGGCCAGCCCGATCTCATCGCTCGCTTCAACGCCTTCCTCGCCCCCAACCCCAAAATCGAGCTCACCGACGAAGACATTACCGCGGCAAAGCAGCGCAGCAGGAAAGATGACCGCCGCAGCACGCCCGTCACCGCCGGCCGTGCCGGCGCGCGGGACGATTCGTTCGACAAAGCCTTGCTGTTCTTACAGCGGGTGAAGCACACGGACGCTGAGCTTTACGACAGAGTCCTCGCAGAGCTATCCTACGTGGAGATGGAGGGAAGGATGGACGCTCATCAAGTCTATGCACGGGCTGAAGAAATTTTCGGCCAGGCACATAGCGACCTGCTTCGCGGTTTCGCCGAGTTCCTTCCAGCGGAGCACAACCCGCCACCAAGTAGTGCAGAAGAGGAGCCGGAAGAGCATCGCCGGACATCGAAGCGCAAGCCCGCCCCTAGCGCTATCGCAGACGACGTTCCCAGCAAGCCGAGCAGGGCCAAGAAACCCCGCGCCGACGACCGCAAGAACCTGCG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000943 Download
Protein sequence
Protein sequence
MASIVASKRIPLVRAAEKLLAASSAPDVSAALRSVAVAGGVRGYNSSAPLRSYESDDDSGREYDDRRRARDIAVPSFFSDVFRDPFSAPQSLDRLLRLMDDLAAPSRAAPLRRGWNAKEEDEALHLRVDMPGLGKEHVKVWAEQNCLVIKGEGEKDSEEEGAATPRYSGRIELAPEVYRMDKIKAEMKNGVLRVVVPKVKEERRRDVFRVNVE
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above