gene PH01000770G0270
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000770:236104 - 237441(+ stand)   Name
Alternate name Locus tag PH01000770G0270
Length of gene 1338  bp Length of CDS 939  bp
Product information
Feature type
CDS
Product name
OsSPL17 - SBP-box gene family member
Alternate name
Molecular weight
(predicted)
34173.6592199999  kDa
Isoeletric point
(predicted)
9.09299850463867
Length
312  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_177742 4
Please click OG5_177742 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os09g31438.1 OsSPL17 - SBP-box gene family member, expressed 2E-116
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 312
Detailed signature matches
    1. SSF103612 (SBT domain)
    2. PS51141 (ZF_SBP)
    3. PF03110 (SBP)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding

Cellular Component

GO:0005634 nucleus

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 190527 47 77 1.94E-17 pfam03110 SBP cl03894 N
superfamily 190527 47 77 1.94E-17 cl03894 SBP superfamily - N
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000770G0270 gene.
CACCACCATCCTAAATACCAAACTGAAGTAAAAGCATCTGCTATATATTGCGCATTGGTGAACTTTTTGAAGAAAAAAATATTGTGCCATACCATTTCACATTGTCCTGTGGCCTTTTATGAATCATCAGAAAAGAGAAGGTTCTCGCTGCTGTTTGATAGATAAAACATCACTTATGACTATTACTGTACTAGTATAAGCCTTCGCGCGTGTCCACTATCTTGGAATGATTACAGATTTACAGGTGCTCTTTCCACATGGTAACCTTTTGTTTTCCCGGCCTGGTGTATGGATCTAATCATGAAAGGCGTGTCTTTGGTTGCTGTTGCTGCTTCAAACAAATGCGAATTAGTTTAGGATTATAAAAGAACAAATGTTCTGCTTGCATCGAGGCAGCTTTTCACATGTTATGTGGTTTGCTTTGTTTAGTTATCTTATACATGCTTAGTATTAAGATAAGCAAGTAGCTGATTCTTGATTACAGAGTTAGCATTTCCCCTCTTTTCATGTGCATGCAGTTTTTTACGGTAAGAATCTCTATTATATGCAATTGATCCATGAATATTATTCACTCTGTTTTTGTTGTGTGAAATTGATTATTGTTACCATTTTCAGTATACTGTTAAAAGGAATTTGGTACTCTTCATCAGTGTAACTCGTCAGATTTTTAGATGCTGCCTATTCTCTTGTGACTTTGCACTAGTAAAATCATCTGTGGAGTTTTGGACCATATGTAATTCCTTTATCCACGTAAATCACAGGTTCCACCAGTTGCCTGAATTTGACCAAGGAAAACGCAGTTGCCGCAGACGCCTCGCAGGTCACAATGAGCGCCGGAGGAAGCCACCACCTGGACCTCTCTCTTCACGCTATGGTCGACTTGGTGCATCCTTCCATGGTAACAAGTGCCTCTCTTTTTACGTATCCATACACTTGCAATTCAATTGAATGTGTTAACGCCCTGTTCTTGCAACTTTTTGTCCAGAAGAGCCCGGCAGGTT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGAGGCCGGGCAGCAGCGGCGGCGGGGGAGAGGACGTCCACGGGCTCAAGTTCGGCAAGAAGATCTACTTCGAGCAGGACGCGGCTGGCGGGAGCGGGAGCGCGGCTGCGGCGGCGGTTGGCAAGAAGGTTTTTTACGGTTCCACCAGTTGCCTGAATTTGACCAAGGAAAACGCAGTTGCCGCAGACGCCTCGCAGGTCACAATGAGCGCCGGAGGAAGCCACCACCTGGACCTCTCTCTTCACGCTATGGTCGACTTGGTGCATCCTTCCATGAAGAGCCCGGCAGGTTCAGAAGCTTTCTACTGGATTTCTCGTACCCAAGGGTTCCAAGCAGCGTGAGGGATGCGTTGCCAGCTATTCAGCCCGGCGACCGCATGTCTGGTACTATCCAGTGGCAAATGAACCATGAACTTCATCCTCACCGCGGTACAGTTGCGGGATATGGCGACCATGCATACAACGGCCAGGGCGGCTCAGCGTCAGGGACACCAATGCTCCCGGCCTTTGAGCTCCCCGCAGACGGATGTCTTGCAGGAGTTGACACCGAATCCAGCTGTGCTCTCTCTCTTCTGTCAACTCAGCCATGGGATAGTACCCACAGTGCCAGCCACAACCGGTCCCCAGCAATGTCGACGACCAGCACCTTCGAAGGCAACCCAGTGGCGCCCTCGGTCATGGCGAGCAACTACCTGGCGGCAAGCAGCTCCTGGAGTAGCTCCCGGGGCCATGAGGGCTCCAGGAACGTGCAACAGCATCACCTGCCGCATGAGGCTGCGCTGCACGAGGTCCATCCAGGCTCAGTTCATCACGATCAGTTCTCCGGCGAGCTCGAGCTCGCGCTGCAGGGAAGCGGCCCGCCGAACCAGCCGCAAGTCGAGCATGGGTCCGGCAGCTCCTTCAGCCACTCCAGCAATGCCATGAACTGGTCTCTGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000770G0270 gene.
ATAAAGAGAAGTCAGAAGTTCTCTTATATCTCTGTGTTCAATTTACTATTATGTTCTTACATTGTTCTTACGATTCTGAGTTTGTGTACTAGATAATCGCTCGGACTGGACTACCTCTAGGCCTATTCTATTTGGATCAAAAGGTAACCGTTGTAACACGATGCTCGTAGATCGAATCGAATTTTCTAAATCGCTTTCAATTCTGCAAATTTGGCTTTTTAGAGTCTTTTCTACGGTGCAAATCCGCTCTAATCTACCTCGAGCCGACTTGAAGTTGCCGACCAAACTGATCGGTGGGTTGCACGAAAGAGCAGATGACGATTGTACTGTAGATTATACATCGGATAAACAGTATTGCATGAATAATACACAAAACGAAAAAAAACAACAGCCGACAGCCCTGTATGGCCATGCTGCTGCCGACTTGCCACCGGCCTCTGCTCCGTGTCTGCCAGAAGCCGCGACACCACCACAGCGCTCGCAGAAGTGCCGCTGGCCCGCAGCCACGCTGGCTCCCGACCGCGCTGCTGTTCGGATGTGCACATGCCGGCCATGCCCCCCATGCTCGCCCGCCGCCAGCCATCTGCACGGGTGCATGGCACAGTGAAGAAAAAAAAAGGAGGGGATGGCGCCGACGCCGCACGGGAGCGCCGTGCCGCCGCCGGCCCGGCATGGCCACCGTGTTCTTTGGCCCCGCACGGCCACGAGCCACTGCGCTGAACACACGTACACGCCACCGTAGCCGACCCGTACGGCTGAGGCTCACCGGCCAAAAGCCACTGGTCGCCCGCACGGTCCCCCACTGCATGGCCGCACCGCCGGCCCGAAGCAGCCTCCGTGCCCGTGCCAGGCTGTGCCACCGTTGGAGCAAGCACCCGCATGCGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCATGCGCCGCCGCAACGCCCACAACCGACCTGCATGAAGCCGCGCACCGACCATGGAGCCGCAGTCGGCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000770 Download
Protein sequence
Protein sequence
MEAGQQRRRGRGRPRAQVRQEDLLRAGRGWRERERGCGGGWQEGFLRFHQLPEFDQGKRSCRRRLAGHNERRRKPPPGPLSSRYGRLGASFHEEPGRFRSFLLDFSYPRVPSSVRDALPAIQPGDRMSGTIQWQMNHELHPHRGTVAGYGDHAYNGQGGSASGTPMLPAFELPADGCLAGVDTESSCALSLLSTQPWDSTHSASHNRSPAMSTTSTFEGNPVAPSVMASNYLAASSSWSSSRGHEGSRNVQQHHLPHEAALHEVHPGSVHHDQFSGELELALQGSGPPNQPQVEHGSGSSFSHSSNAMNWSL
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above