gene PH01000753G0380
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000753:227334 - 242605(- stand)   Name
Alternate name Locus tag PH01000753G0380
Length of gene 15272  bp Length of CDS 1644  bp
Product information
Feature type
CDS
Product name
histidine acid phosphatase
Alternate name
Molecular weight
(predicted)
62784.2515200001  kDa
Isoeletric point
(predicted)
7.0149803161621
Length
547  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP04163050 PH01000753:231345 G G_A
PH01SNP04163060 PH01000753:235354 G G_A
PH01SNP04163070 PH01000753:239766 G G_A
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_127768 8
Please click OG5_127768 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G15070.2
Phosphoglycerate mutase-like family protein
Phosphoglycerate mutase-like family protein; FUNCTIONS IN: oxidoreductase activity, transition metal ion binding, acid phosphatase activity; INVOLVED IN: oxidation reduction; LOCATED IN: cellular_component unknown; EXPRESSED IN: petal, embryo, leaf whorl,
0
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os03g48300.1 histidine acid phosphatase, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
    1. PS00616 (HIS_ACID_P...)
    2. PF00328 (His_Phos_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR12750 (UNCHARAC...)
  2. PTHR12750:SF4 (UNCH...)
  3. SSF53254 (Phosphogl...)
  4. SSF56059 (Glutathio...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003993 acid phosphatase activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 117020 119 321 2.55E-05 pfam08443 RimK cl17255 -
superfamily 247809 119 321 2.55E-05 cl17255 ATP-grasp_4 superfamily - -
non-specific 215860 379 396 0.0022396 pfam00328 His_Phos_2 cl11399 C
superfamily 245601 379 396 0.0022396 cl11399 HP superfamily - C
multi-dom 223267 82 311 1.58E-05 COG0189 RimK - N
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000753G0380 gene.
TGAAACTGCAACAAACTTCTAAGTTCTAATTGTCGCAAAATTACTTTTCCCTGCAAGCCATTGCACTAAAGGTCCATAAAGTTCAAAATCGCCCTGGTAGGTCCCTATCCAATTTGACTACCTCTACGGGATAGACCTCAACAGTTAAAACTTGATAAATATGCCACTTTGATCAGTGGACTTACAAATTTGCTGATGTAGAAATGTTTAAAAACATAATTGATGTAAATATCATACAGATATTTAAGTATCTAAATAAGTTGTAAATATATAAAGTGGAAATGGAATTCTATAATTATTTATCAGTTTTATAACCATCATCAGCTTCATGTGCCATTCAATGACTCCCACATGCTTACATGCATCAACCATTTATACCTGCCACCTAAGTACCTATATCCAAACTCTGTTGCCACATTAGAAAATTCACAGTTAAAACCGTTGTAGCGACCTAAGTGGTATGAAGTTCAAGATTAGGAGCCCACCAAGATGATTTTGAAGTTTAGGGAGTAGGGACCTAAGTGGCAGCACCACTGCTCAAGTTTAGGGATCTCCGACGCAATTCTCTTGAAAAGAACATCCAACATAGAGAAGCTCCAGATTGTAATAAATAAATATTCTCACTTTGAATAAGTCAGCTATTTAACTTCTTTCACAAGATATTATAAACAAGAATGTGAACAAGAACCTGGATATATGTTGTTTCTGAAAAACCTTCCCAACTCTTCTGCCTGAATGAAAAGAGTAAAAAAATCATTACACTAGATACATGTTGATTACCAATGTAGCTACATGAAATTTGCTCTTGTCGTATCCAAATTTGGCAAGTAGCTCATTGAACATAAGATTATTTGAAACAACAGAAAATGATGCTTCAAGCAGAGAGTAATGTTATTCAGTAATTACTGGTTATATGCAAGGTAGTCGGGATTCTGAGTCAAAAATATCTATCGAATCGTAGAATCGTGGATCCTACCAAATTTATAAATAAATGCATATGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGACGGTGGAGAATAATGGGCGCGCCGACACGATCACCATTGGCGTCTGCGTCATGGAGAAGAAGGTGTTCTCCTCTCCAATGGAGCAGATTCTCGAGAGACTCCACGCATTTGGAGAATTCGAGATCATAATATTTGGAGATAAGGTTATTCTCGAGGATCCTATTGAGATGTATGTAATGAGAACTCAGGAGGAACATCTCACTTATCCACAATTTTATTTCAGTTGGCCAAAGTGTGATTGCTTGATTGCCTTCTATTCGTCTTGTTTTCCTCTTCAAAAAGCTGAGGCTTATGCTTCTTTACGAAGGCCCTTTTTAGTGAATGAATTGGAGCCACAACACCTCCTTCATGACCGCAGAAAAGTATATGAGCATCTCGAGAAGTATGGAATTTCTGTACCCAATTACGCTCTTGTCAATAGAGAATATCCATACCAAGAGCTGGACTACTTCATTGAGCAAGAGGATGTTGTTGAGGTTCATGGAAAGAGATTTTTGAAGCCCTTTGTGGAGAAACCTGTTAATGGGGATGATCATAGAATAATGATATATTATCCTAGTTCTGCTGGTGGTGGAATGAAGGAATTATTCCGAAAGGTTGGTAACCGTTCTAGTGAATTTCATCCTGATGTCATGAGAGTGAGGCGTGAAGGATCTTACATTTACGAGGAGTTCATGCCTACTGGTGGGACAGATGTGAAAGTTTACACAGTTGGCCCAGGATATGCACATGCTGAGGCACGCAAATCACCAGTTGTTGATGGTGTTGTTATGAGGAACCCTGATGGGAAAGAAGTACGGTATCCTGTGCTTTTGACCCCTACAGAGAAACAAATGGCAAGAGATGTCTGCAGTGCTTTTAGACAGATGGTTTGTGGTTTTGATCTCTTAAGGTGTGATGGAAGATCATATGTTTGTGATGTTAATGGATGGAGCTTTGTAAAGAACTCATACAAGTATTATGATGATGCTGCATGCATCTTGCGAAAAATATTTCTCGATGCAAAAGCTCCGCATCTTTCGTCAACCATTCCTCCAAACCTTCCTTGGAAATTGAATGAACCAGTTCAGTCCACTGAAGGTCTTACACGACAGGGAAGTGGAATTATCGGTACATTTGGGCAGTCAGAAGAACTACGCAGTGTCACTGTTGTGATACGCCATGGTGACCGGACACCAAAACAGAAAGTGAAATTGAAAGTTACAGAGGAAAAGCTCCTGAATTTGATGTTAAAGTACAATGGTGGAAAGCCAAGAGCTGAGACAAAACTAAAAAGTGCCGTACAATTACAAGACTTGCTAGATGCCACTAGACAACTTGTACCACCAACTAGGTCTGGTCAGGAGAGTGATAGTGATGCCGAAGATTTGGAGCATATTGAAAAGCTTCGTCAAGTCAAAGCAGTACTGGAGGAGGGTGGGCATTTCTCTGGTATTTATCGGAAAGTGCAGCTAAAGCCACTGAAATGGATTAAAGTTCCAAAGCACAATGGTGATGGTGAAGAGGAATGGCCAATTGAAGCCCTGATGATTCTGAAATATGGTGGTGTACTCACTCACGCGGGGAGAAAGCAGTGGTTCCTTTTCAATACCTTCCACATGGTAGCATGTGCTATTGGGCATCTCCATAGAGAACAGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000753G0380 gene.
GATAGTATTTTTTGAGAAAAATCTATATATATGATTTTTCACATATCCAATATAAAATTCTAAAAAGATATCAATGACCAAAGTTTTAAAATTTTGATTACACGTATCTCAAAACAACATATTATGTTTTTGTGTGTGGAGGGAGTATAAAGCAACAAACAATCTCAGTCTTTAACTAGGTTGGTCCTTAATCTCTACCTTGTGACAATCGTTGAGCTGCTGAAATTTCTGTCGCTTCAAATCATATCTTCTGGGTGTACTTTACTACTGTTGCTGAGTATTAAGTATAGGGTCTGTCTTCTATGTAAAAAATTGTCACATCTTGAAAGTTTATTTACAACTCCATTGTTCATAAATTATAGTAAATTATTTATATAATTTTGGTTCTTGATCACTGTAATTATTCTTGAAAGTCTTAATAACTTACATTTTCCATCACATGATTCAAAATCTCACATGTACTTTGAGAGGTTGAGCAAAAACAAATCATTTACAACTCCATTATACATAAATTACAGTAAATTATTTATGTAATTTTTGTTCTTGGTCGCTATAATTATTCTTGAAAGTCTTAATAACTCATATTTCCAACACATGATTTAAAATCTCACATATACTTTGAGAGGTTGAGCAAAAACAAAGACGAAAAAAATTATATACCAACAAAATACGGTAATATGGTGAACCCGTTATGTCCTTCACGTGTACTTTGAGAAGCTGAGCAAAAACAAAGACAAAAAATAAATTATATACCAACAAAATATGGCAATGTGGTGAACTTGTTGTGTTCCGAATAAATAATAATAATAAATTCGGACCCAATTCATCATATGGGGAAAAATGCAAATCTCAAAGCATATCGGACAAATGAAAATTCAACTATTATGATTTTTTTTACAGCACATCAACAACACGAATCACATATGGCTTTGTGAACAAAGAGGAAAGTAAACTTAATTTAATCGATCTCTTCTATTCAACAAAAGATTAAAGGGATGCTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000753 Download
Protein sequence
Protein sequence
MTVENNGRADTITIGVCVMEKKVFSSPMEQILERLHAFGEFEIIIFGDKVILEDPIEMYVMRTQEEHLTYPQFYFSWPKCDCLIAFYSSCFPLQKAEAYASLRRPFLVNELEPQHLLHDRRKVYEHLEKYGISVPNYALVNREYPYQELDYFIEQEDVVEVHGKRFLKPFVEKPVNGDDHRIMIYYPSSAGGGMKELFRKVGNRSSEFHPDVMRVRREGSYIYEEFMPTGGTDVKVYTVGPGYAHAEARKSPVVDGVVMRNPDGKEVRYPVLLTPTEKQMARDVCSAFRQMVCGFDLLRCDGRSYVCDVNGWSFVKNSYKYYDDAACILRKIFLDAKAPHLSSTIPPNLPWKLNEPVQSTEGLTRQGSGIIGTFGQSEELRSVTVVIRHGDRTPKQKVKLKVTEEKLLNLMLKYNGGKPRAETKLKSAVQLQDLLDATRQLVPPTRSGQESDSDAEDLEHIEKLRQVKAVLEEGGHFSGIYRKVQLKPLKWIKVPKHNGDGEEEWPIEALMILKYGGVLTHAGRKQWFLFNTFHMVACAIGHLHREQ
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above