gene PH01000718G0330
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000718:210024 - 218651(- stand)   Name
Alternate name Locus tag PH01000718G0330
Length of gene 8628  bp Length of CDS 1962  bp
Product information
Feature type
CDS
Product name
expressed_protein
Alternate name
Molecular weight
(predicted)
72172.1666200002  kDa
Isoeletric point
(predicted)
8.53816604614257
Length
653  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_176140 2
Please click OG5_176140 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os03g10180.1 expressed protein 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 100 200 300 400 500 600 653
Detailed signature matches
    1. SSF46565 (Chaperone...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR23172 (AUXILIN/...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 185317 577 630 0.000591443 PRK15419 PRK15419 cl00456 NC
superfamily 241874 577 630 0.000591443 cl00456 SLC5-6-like_sbd superfamily - NC
non-specific 233735 594 630 0.00651497 TIGR02121 Na_Pro_sym cl00456 NC
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000718G0330 gene.
GCCCTCCGGGAACCACCGAACCCTTGGGCCCCTGTTGGGACCCTTGGGGCGACTCGAGCAGCTGGGTCGTGCACGCTTCACTGTTCACCAGGTCGTGAGGGCCGTTGTACCGCCCCTACGACACGGCGCGATTGAGCAATGTAAAGAACCGATCCTGGTAGTCGGCGACTGTACCTATGCACCGGCATGACGCTAGTTCCCCAAAAAGGGTTGTTGCGAAGGGGTGGGCCAAAGCGAAGGTTGACGAGCTCGGTAAAGCGCCTCCAAATTGGTGTTCCGCCATCTCGTTCCAGCCGATAGTACTATTGTTGGGCGCCATCAATGAGGTGGTAGGCGGCGAGCCATACTTTTTCTTCCTCCAAGGTTCGCTACCCGTGAAAGAATTGCTCGCGCTGGTTGACCCATGGAAGCGGATCACTTTTGCCGTCAAAGGTCGGAAAATCCAGCTTGTAGTAGCGAGGAGGGGCGCATTCGATAGAAGCAGCCGACGGTGGCTCCCGTGGAGCCCTGAGAGGGCCGTCGGGCATGGTGGTGACCGCCTGGCTGCACTTGAGACGGGTGATGGCTTGCTGTTGTGTGTGCTGCGCCATCTCCAAGTTCTGTAGCTTGTCTTCAATGGTGTCGAGTTTCTTCATCTGCGCCAGGATCGCTGCAAGTTGTGCAGACACAGCATCGCCGTCGCCCGCCATGGAGGAAAGGGCAATGCCTGAATATGATACCAAGTTTCAGGTGTGTGCTCTGATACCAAGTTGTTGTGTGCTTCGGGAATAAAACGTATGGGGTAGGTGTGAAAGGTGGGTGATTTCGGCCCGGGCTTGCTCCCGGAAGCCATGGTGAGGAGGGGGAGGCACGCACGGGCAGAGGGGGCCAGCGTGCGCCTGTAGGCCGGGAGGAGAGTGGGGTGAAGAGATATTAGAGATTCTAATCTTGCTTGCTTTATTTCTTCATCTTCTCCCCTTTAAATAGAGAGACTTACAATAAAGAGATTGTAAAAATCTAAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGCGCGCTGTACCGCCCAAGGAAAAAGATGACCAGGAGGAGGGCGGAGGTTGACAGGCGGGCCCCACCGATAAGCAAAGCTGGAGCAGACAGATTTCTAAGAAAAAATACGATTAAACCATTTGACTCCACAGCAATAGCAAACGCTGCAAAGGGTTGGCAAGCTAATCGTCTCACTATCTGCACCCGCTTTGTCCTCTCAGATTTAGGCAAGGAACCCCATCTAAGAAGCTTCTCCATGAAGTTCACCAGAGGCGTGGATAATTCAGTGCCTACTTCTCCATCCCGGCATACATCCAAGAGAAACGATGATGGAACATCCTACGCTTACAGCGTTCCGTCTTCACCGAATGCATCCACGAACAGCTTTCTAGCCCGAGGGGCACCCCAACAGGATTCCAGGAAAAAACCCTTTACATGGCATCGCTATCCCTTCCTATCCCGGTTTCGTTCTCAAAGTGGAGAAAAGAAGGACACCTCTCACTCTCATTATGTCAGTTCTATGGACAGTGAATGTGAAGGGACTCCTGTTAGCTCGGAAAGTTTCATTGCCAATAACAAGTTCCATTTTTCATTCTATACGTGGGCGGGGAAAGGAGCCTTCTTGATGCTGCCAACTTCTCCACACGAAAAGGCTGGAAATATTATTGGAGTGAGGAGCTTCCCTCAAGTGGTTGTGCAAGGCATTGACCTAATTGATGAGGAAGACAGCATGTCAACCGCCACTGGTGCATCCAAGAGTCAGACTGACTACGAAGATTACAAGTCTGCCAAGGATGGCTTGTTTGAAAGAAAACAAAGTACAAACTCAACAAACAAGGAGGGGACTCTTCCTTTAGTGTTTGATGACTCCATGCAGGGTGATAAAGCCGAAGAAACAGGAACAAAACATAGCACCAATAATGCAAAGAACAATGTATCAGCAGCTAGCCCCAGTGCTCAAAGTTCTCTGTCACCTTCAGGGGAGAAAAGTCGTGGTAGCAGAGTGAAGGAAAAAGTAAAGGACTTCATCAAAATATTTAGTCCCGGGAGTTCACCGAAGCGCAGAGGAGCACCTGAAGCTCAAGATCAGACATCAAGTGGGAAAAATGGAAGCAAAGGTGAAGCTGAAGATAAATTTAGCTTATCCAGTTTGGAGGTCGATGAGGACGTCAAAACAGCCAAAATGAACAATCAGAATGCATTTTCCGCGGCACCTAATCCAATGAGTGAAGTGCAATATAGGATGGAGAAACCGGTCCTACCAGTGGATAATGAAATGCAAACCAGAACAGGCAGATTTTCCGGAAGAAAAGAAGTTACACCTCCATCTTCTGATGAGTCAATCCATGCTGAAACAAAAGAAAACGTGGGCGACACAACAGATTGTGAGGAAAGTCATGTAGAAGATCTTGACGGATGTGTGCCTGTATGTGCCATTTGCTGCTATATTCCGCAAATTGGCTCAGGGCCAACATGGGGAATAATGATACCAAAGATAGGAAACGATGTTGAGCATTTCTCTGAAGATCCTGTTCTTCGTAATGATGAGGAAAAAGAGCAAATAAAGATATCTGAATCCAAAATCAGGGAATGGTCAAAGGGAAAAGAAGGAAATATTAGGTCATTGCTTTCTACACTGCAATATGTTCTATGGCCTGAGAGTGGATGGAAATCAGTACCCCTTGTTGATATAATTGAAGGAGCGGCTGTTAAGAAAGCCTATCAGAAGGCATTGTTATGTCTTCATCCAGATAAGTTGCAACAACGAGGTGCTGCCATGCATCAAAAGTATATAGCAGAAAAGGTTTTCGACATTCTACAGGTGTTGTTTGCTCCTTGGCTTACTTCAATTCTCTGGGGTGCATTTCTAGCTGATTTATCTTGTGTGATGCTCGTGGCCTCTTCTTGTGAAGATGTCATGTGCAGCCAGGTTTACAGCCGGTACCACAAGGGCCCGGCCCAACCGACGGTAGCTTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000718G0330 gene.
GTCACCCTCTCTCTCAGCCTTCCCCGTGCCTATTTAAAGCGCGCATCAAGTGCGCCATGGCCGCCTCTCACTTTCCCCTCTACCCCCTCTCTCCCTCGCCCTAGCCCGGCCGCGATTCGAGTTTTCGTCGCAGCCTCTAGCGCCGCCGCTATGCCTCATCCGCCGCATTCGCCTACACCTTCGGCATCGCAAGCTCGTGGTCCATCCCGTGCGCACCTCCCCTTCCTCTGGAGCCCACGGGAACGCCACTGCCGCCTTCAACCGCCGCCACCGCCATCCTTTAGCGCCATCACGACGAGAGCGTGAGCCCTAGCTTCGTCGTGTTTCCCTCTACCTACTGCTGTCCCCGCCGCCGGCCAAGACCCGGCCGTTCGCCGGTGAGCTCTACCGCCTGAGCGCCATCACTCCAGTCCAACGTGGAAGTGAAGAAGCCAGGCAAGTAACAAGAACGCCCAGGCGTTCATTTTGAGCGCCCGGCAACTCACCTAGGCATCTCGCCAGGCCTTCTAATTCCTAGGTCTCCAACCAAACGAGCATCAGGCAGACTTCAGGAGGTGCCCCGGCCAGACTAGGTCATATCAGGTCCCAAACCAAATAGACCCTTAATCCAACATCTTATGGCGCGAGCTGATGGCAGCCATGTACCACTTGTATCCGCGCTCCCAAGGGCACCCCTCTTTTTTAAGAGGATTCGTGGCATGCCAAGCCTTAGTAAAGTTCTTCACTTTGCATCAAATCAAACCACACGTGAGCCACTGCTTAAACTCGGATGGGCTAGAGCCTAAGCTCCCCTTAAGCCAACGGACCTAGGCTCAGTCTTTAGTTCTGTGAATATGATGAGGTGTGTGTTTCTAGCATGCACACTTTTGCCGGTACCAGGGAAAAGATTCCTGCTATCGGAACCACGAATTACTCCGTTACCAAGCCCAATAAACTAATAATGGCCCCACATGCATGTGTCATGTTATAAGGAGGTATAATGGAGTAGTAGACACTTCCAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000718 Download
Protein sequence
Protein sequence
MGALYRPRKKMTRRRAEVDRRAPPISKAGADRFLRKNTIKPFDSTAIANAAKGWQANRLTICTRFVLSDLGKEPHLRSFSMKFTRGVDNSVPTSPSRHTSKRNDDGTSYAYSVPSSPNASTNSFLARGAPQQDSRKKPFTWHRYPFLSRFRSQSGEKKDTSHSHYVSSMDSECEGTPVSSESFIANNKFHFSFYTWAGKGAFLMLPTSPHEKAGNIIGVRSFPQVVVQGIDLIDEEDSMSTATGASKSQTDYEDYKSAKDGLFERKQSTNSTNKEGTLPLVFDDSMQGDKAEETGTKHSTNNAKNNVSAASPSAQSSLSPSGEKSRGSRVKEKVKDFIKIFSPGSSPKRRGAPEAQDQTSSGKNGSKGEAEDKFSLSSLEVDEDVKTAKMNNQNAFSAAPNPMSEVQYRMEKPVLPVDNEMQTRTGRFSGRKEVTPPSSDESIHAETKENVGDTTDCEESHVEDLDGCVPVCAICCYIPQIGSGPTWGIMIPKIGNDVEHFSEDPVLRNDEEKEQIKISESKIREWSKGKEGNIRSLLSTLQYVLWPESGWKSVPLVDIIEGAAVKKAYQKALLCLHPDKLQQRGAAMHQKYIAEKVFDILQVLFAPWLTSILWGAFLADLSCVMLVASSCEDVMCSQVYSRYHKGPAQPTVA
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above