gene PH01000689G0270
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000689:239918 - 241696(+ stand)   Name
Alternate name Locus tag PH01000689G0270
Length of gene 1779  bp Length of CDS 456  bp
Product information
Feature type
CDS
Product name
heavy metal-associated domain containing protein
Alternate name
Molecular weight
(predicted)
16633.3779199999  kDa
Isoeletric point
(predicted)
9.19115829467773
Length
151  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_177531 1
Please click OG5_177531 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT1G71050.1
Heavy metal transport/detoxification superfamily protein
Heavy metal transport/detoxification superfamily protein ; FUNCTIONS IN: metal ion binding; INVOLVED IN: metal ion transport; LOCATED IN: cellular_component unknown; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro
1E-47
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g32330.1 heavy metal-associated domain containing protein, expressed 2E-76
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 20 40 60 80 100 120 140 151
Detailed signature matches
    1. SSF55008 (HMA, heav...)
    2. PF00403 (HMA)
    3. PS50846 (HMA_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR22814 (COPPER T...)
GO term prediction

Biological Process

GO:0030001 metal ion transport

Molecular Function

GO:0046872 metal ion binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238219 37 91 4.32E-12 cd00371 HMA cl00207 -
superfamily 241686 37 91 4.32E-12 cl00207 HMA superfamily - -
non-specific 215902 33 88 3.76E-10 pfam00403 HMA cl00207 -
non-specific 225328 28 93 2.92E-05 COG2608 CopZ cl00207 -
multi-dom 182635 37 91 4.27E-05 PRK10671 copA - C
multi-dom 236827 37 87 8.61E-05 PRK11033 zntA - C
multi-dom 215516 35 90 0.000300262 PLN02957 PLN02957 - C
multi-dom 225127 37 92 0.0039479 COG2217 ZntA - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific metal-binding site M37,D38,C39,C42 4 4 238219
 
DNA sequence
Upstream 1000 bp region from PH01000689G0270 gene.
CGACAGCTACTGAAAAAAAGAAGTGAAGTGTGTAACTGGAATCATATAATCGGAATATCAGGTAGTACCTGATGTTTATAAAAATTATATGCATGCATGTTGGCGCGCCATGTTTACTATTCTTTTCCGTTTGGACCCGTTTGAAACAATCAATAGGAATAGGAGTTTCTTTTCCAACAAAATTTTTACGGAATTCTTATGTTACGTTCCAAAAAACAAAGTTTCCTATTCAATTGAATAAAGGTTTAAATTGCAAAATCAGCAAAAGTAGGTACGAGTATAAAGTGGGACAGGTGTACAAAGCCATTGCAAAGGAGAACCTTGCACACGGCTAAAAACTACTCCGTGACACAAACCCAAAACAAAAACAAAGCAATCACTGTACAGGTGAAGTGGTTTTCTCCGGGAAAAAAGTGTTGGTTGTGATAGATCCATCTCCCTTTATGCCAAAACTATCAATCAAGAACTAAGCTATCATCACTTTAAAGATTGTACTACTTAATTTTGGAAGTAGAACATGGATCAAGATTGGAATCGGGATTAGATTGCTTTAGCTAGGAGAGAGAAACCAGCTATATCTTTCAGAATGATCCAAAGAACAAGATCCGATGCAAAGCAATTCATTTCTCTTAATGCCCTTTTCTTCATTTTGCTTGCTTGCAGGGTTGGAATGTCACATTCAGGACACCTTGCGTTGTTGGAGCGATGGGTTCCTCTCCAAACAACTGGACCTTAGAAACTTACATGGATCTTAATGTTCACACTGTCATTATCAAAAAGAAATTTTGGTACATGGTTAAAATCTCACATCTGATTCTAGTGAAATGTTTAATCTGATTGTCAATTATTCTTCACAATGTAAAAAAGGAGGACAGATTATAGTTTGGTGTTGAGTGTTATGAATATTGTATGTATATTGAAGAGACTCAATAAGCAATATATATAGGGTGTACAATATATATAGGGTGTACAAGGGTGATATACCGTATACATATAAGAAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGCGCCTTGGATCACCTCTCTCATCTCTGCAGCATAACTGAGACCAAGGAAACCCTGAAGCTCAGGAAGAAGCGGCCGCTGCAGACGGTGAACATCAAGGTGAAGATGGACTGCGAGGGCTGCGAGAGGAGGGTGAAGAACGCCGTGAAATCGATGCGAGGCGTGACGAGCGTCGCTGTGAACCCGAAGCAGAGCAAGTGCACGGTGACGGGGTACGTGGAGGCCAGCAAGGTGCTGGAGCAAGTGAAGAGCACGGGGAAGGCGGCGGAGATGTGGCCGTACGTGCCCTACACGCTCACCACCTACCCCTACGTCGGCGGCGCCTACGACAAGAAGGCGCCGTCGGGGTTCGTCCGCAGCGCGCCGCAGGCCATGGCCGACCCCAGCGCGCCGGAGGTCCAGTACATGACCATGTTCAGCGACGAAAACGTCAACGCCTGCACGGTCATGTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000689G0270 gene.
ATAAAACCGGAGGGAGTATATGCTATCTTGTTTTGGGTCTCTAAATGCTTCAAAAAAAAAGAAAGAAAGGAAGAAAACTTTGTTCGGTTTGGAGTTTTTCCTGTGTATTACGAATTTACGATATATGTTTGAAGAGAATTCGTACGCGCGTTATCTTTTTGTTTGGTTGAACCACTCTGTAGTCTCTATCTCAACTAGAAGGTAACCCGCGCCAATGGTGCGGAAGTGATTGTTGATAGGCCTGAAGAGGGTGCGACAATGTTCTGTTCGTCGTGGGTCATCAGTCTTAATAATATCTTATTTGTGTAGAAAGTGCATTTTTTTAAAACCTTGGCCTGGTACATGTTGATTGTCAAAGCAAAGGGAAACGGTAGCAACAATAAACATATGTGTCATGTAAAAGTAAGATATGTGTTTTTTGGTTTTCTTTTTTTGGTAGAATGTAAAAGGAGCAACGAAAAATCTCAAATAAGGAGAAACATGCTCTGTTGAACTAATTCTATCGACCTTATAGTTTTTGGTTAGGCTCTATAGAAATGGATTGTTTCGGTACGTCAAGAATAATAGACTGATACATTTCTTTTCTAAGCAAAGGGACCGTTTCATAAATACTAAGATGTAGCATTTGTAAATATATATGTTTAGGGTGTCTGTAAGTATAGTGTGTTCATAATTGGCATCTATGTGCAGAGTCTACCTGTGGATTGTGAGCGTCTCCTGCAAACGTCTGAACAATAAATAGATCTTTGCGCACGCTGTGTGTGCCATGCCCGATCTTTGAGCTGCAAATAGTAACATGCAGTTGTAAGTTGAGTACCACAAATAGGAAAGCTAGTAAGATATAGTGTCTGATAGAGGGGAACAAAGGTCTCACGATAGAAAGGTAAATACCTGAAAGAAACGGCAGGCATAATAGCGTGTTTTGTCATAGAGGGCGGTGTTCCCTGAGGACGGGCATCATGTAGCTGGTACGTCGTGGAAGTGCAACGTTAGTATGGTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000689 Download
Protein sequence
Protein sequence
MGALDHLSHLCSITETKETLKLRKKRPLQTVNIKVKMDCEGCERRVKNAVKSMRGVTSVAVNPKQSKCTVTGYVEASKVLEQVKSTGKAAEMWPYVPYTLTTYPYVGGAYDKKAPSGFVRSAPQAMADPSAPEVQYMTMFSDENVNACTVM
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above