gene PH01000667G0420
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000667:381478 - 388256(+ stand)   Name
Alternate name Locus tag PH01000667G0420
Length of gene 6779  bp Length of CDS 1236  bp
Product information
Feature type
CDS
Product name
dnaJ domain containing protein
Alternate name
Molecular weight
(predicted)
44920.28282  kDa
Isoeletric point
(predicted)
8.73411178588867
Length
411  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP03793730 PH01000667:387670 C C_T
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_126773 9
Please click OG5_126773 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g13760.1 dnaJ domain containing protein, expressed 4E-105
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 411
Detailed signature matches
    1. PF00226 (DnaJ)
    2. PS50076 (DNAJ_2)
    3. PR00625 (JDOMAIN)
    4. SM00271 (DnaJ)
    5. SSF46565 (Chaperone...)
    1. SSF49493 (HSP40/Dna...)
    1. PF01556 (DnaJ_C)
    1. PS00636 (DNAJ_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR24077 (FAMILY N...)
GO term prediction

Biological Process

GO:0006457 protein folding

Molecular Function

GO:0051082 unfolded protein binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 199909 264 397 1.12E-34 cd10747 DnaJ_C cl03262 -
superfamily 243362 264 397 1.12E-34 cl03262 DnaJ_C superfamily - -
specific 99751 4 59 1.50E-25 cd06257 DnaJ cl02542 -
superfamily 243077 4 59 1.50E-25 cl02542 DnaJ superfamily - -
non-specific 215804 4 67 3.61E-32 pfam00226 DnaJ cl02542 -
non-specific 197617 3 62 1.22E-28 smart00271 DnaJ cl02542 -
non-specific 216569 324 402 6.01E-19 pfam01556 DnaJ_C cl03262 -
multi-dom 236757 4 75 1.37E-38 PRK10767 PRK10767 - C
multi-dom 223560 1 75 1.25E-37 COG0484 DnaJ - C
multi-dom 233829 4 75 2.01E-36 TIGR02349 DnaJ_bact - C
multi-dom 240236 173 409 2.43E-34 PTZ00037 PTZ00037 - N
multi-dom 172778 1 70 7.17E-32 PRK14290 PRK14290 - C
multi-dom 237664 4 74 2.89E-31 PRK14294 PRK14294 - C
multi-dom 184611 4 70 1.36E-29 PRK14297 PRK14297 - C
multi-dom 184599 4 73 3.74E-29 PRK14277 PRK14277 - C
multi-dom 184603 4 73 1.55E-28 PRK14282 PRK14282 - C
multi-dom 237668 4 74 9.85E-28 PRK14301 PRK14301 - C
multi-dom 237657 1 74 1.64E-27 PRK14281 PRK14281 - C
multi-dom 237661 4 74 1.72E-27 PRK14291 PRK14291 - C
multi-dom 237654 1 67 2.53E-27 PRK14278 PRK14278 - C
multi-dom 237658 4 74 8.06E-27 PRK14284 PRK14284 - C
multi-dom 237653 4 73 8.34E-27 PRK14276 PRK14276 - C
multi-dom 237663 1 74 1.47E-26 PRK14293 PRK14293 - C
multi-dom 237660 4 74 2.03E-26 PRK14289 PRK14289 - C
multi-dom 237656 4 73 2.05E-25 PRK14280 PRK14280 - C
multi-dom 223560 173 402 7.35E-25 COG0484 DnaJ - N
multi-dom 184604 4 74 4.95E-24 PRK14283 PRK14283 - C
multi-dom 184612 4 74 4.97E-24 PRK14298 PRK14298 - C
multi-dom 172774 5 74 1.77E-23 PRK14286 PRK14286 - C
multi-dom 237655 4 69 1.45E-22 PRK14279 PRK14279 - C
multi-dom 237665 4 68 1.83E-21 PRK14295 PRK14295 - C
multi-dom 237662 3 70 2.85E-21 PRK14292 PRK14292 - C
multi-dom 237659 4 70 8.71E-21 PRK14287 PRK14287 - C
multi-dom 237667 4 72 1.25E-20 PRK14299 PRK14299 - C
multi-dom 172773 1 70 1.57E-20 PRK14285 PRK14285 - C
multi-dom 240236 5 74 2.13E-20 PTZ00037 PTZ00037 - C
multi-dom 225124 4 72 2.99E-20 COG2214 CbpA - C
multi-dom 172788 1 75 4.06E-19 PRK14300 PRK14300 - C
multi-dom 234368 4 74 5.24E-18 TIGR03835 termin_org_DnaJ - C
multi-dom 172776 1 74 1.62E-17 PRK14288 PRK14288 - C
multi-dom 182347 4 69 1.03E-15 PRK10266 PRK10266 - C
multi-dom 237666 4 70 5.45E-15 PRK14296 PRK14296 - C
multi-dom 233829 176 409 6.24E-15 TIGR02349 DnaJ_bact - N
multi-dom 237661 271 408 5.52E-14 PRK14291 PRK14291 - N
multi-dom 227694 2 66 1.77E-13 COG5407 SEC63 - C
multi-dom 184603 276 408 6.81E-12 PRK14282 PRK14282 - N
multi-dom 237654 176 408 1.28E-11 PRK14278 PRK14278 - N
multi-dom 237660 176 408 2.68E-10 PRK14289 PRK14289 - N
multi-dom 172774 255 402 3.58E-10 PRK14286 PRK14286 - N
multi-dom 237657 176 408 1.46E-09 PRK14281 PRK14281 - N
multi-dom 236512 4 57 7.58E-09 PRK09430 djlA - N
multi-dom 184604 165 402 7.97E-09 PRK14283 PRK14283 - N
multi-dom 172773 176 400 1.60E-08 PRK14285 PRK14285 - N
multi-dom 237655 276 397 1.81E-08 PRK14279 PRK14279 - N
multi-dom 237663 255 402 2.09E-08 PRK14293 PRK14293 - N
multi-dom 173534 5 75 2.19E-08 PTZ00341 PTZ00341 - NC
multi-dom 184599 256 402 2.88E-08 PRK14277 PRK14277 - N
multi-dom 237665 263 407 8.51E-08 PRK14295 PRK14295 - N
multi-dom 237662 256 402 3.87E-07 PRK14292 PRK14292 - N
multi-dom 237667 265 408 5.22E-07 PRK14299 PRK14299 - N
multi-dom 237668 256 402 1.14E-06 PRK14301 PRK14301 - N
multi-dom 184612 256 402 1.79E-06 PRK14298 PRK14298 - N
multi-dom 237666 255 408 1.93E-06 PRK14296 PRK14296 - N
multi-dom 237658 264 402 2.86E-06 PRK14284 PRK14284 - N
multi-dom 227594 3 67 6.59E-06 COG5269 ZUO1 - C
multi-dom 237664 270 402 7.00E-06 PRK14294 PRK14294 - N
multi-dom 224002 4 55 1.78E-05 COG1076 DjlA - N
multi-dom 236757 270 402 0.00024231 PRK10767 PRK10767 - N
multi-dom 237659 255 402 0.000419332 PRK14287 PRK14287 - N
multi-dom 172776 272 411 0.000945054 PRK14288 PRK14288 - N
multi-dom 235133 4 66 0.00339992 PRK03578 hscB - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific substrate binding site E272,N296 9 2 199909
specific dimer interface L333,L334,L337,T338,V359,I360,H361,P362,F393,P394,S395,R396,L397 13 13 199909
specific HSP70 interaction site H32,P33,D34,E44,F47,K48,S51,E52 8 8 99751
 
DNA sequence
Upstream 1000 bp region from PH01000667G0420 gene.
GACGGTTCTTAACACTAATCGTCTGTGATAGACATTTATCACATACGGTTCTAAACACGAACCGTCTATGATAGTCATATATCACAGACGGTTCTGAGTTAATAACCGTCTGTGATAGCATGCATCACAGACGGTTCGAAAACCGTCTGTGATGACCCCATGTCATCACTGACCCATAAACTCAGACGGCTCACGAAACCGTCTGTGATGACGTTTTTGAACCGTCTGTGAATGCCTTTTCTGTAGTAGTGCCAGCTCTTGCCAGGGAGCAGTACACAGCACTAGGATACGGACAATGGCAGCCAGGGTTTCTAGTGTACGCAGGGCAGAGCTCCTTCGAGTTCGCTGCCCCACCGTACGTTCAAGGGCAGAGCTCCTCCGGGTTTGCTGCCCCACCGTACGTTCAAGGCCATAGCTCCTCCGGGTACGCGAGAACCTCGTACGTCCAAGGCTAGAGCTCATCCAAGCAACTAGAGTTGCAGGCATCGTACCCCTAGAGTGGTTTTCTAGCCTCCGTCGTGGATGAATTCCTCGGAGGTGTCCCCCAGGTCGGCATGGCTCATCACGACGACATGTACGCCTACCAGACTCTTCTCCAGAGTCAGTCTACTGGTCCACCTCCGCCTCAACGGTCTCCGTACCCCCTCCGAACCAACACGCGTTCTCCGGACCGATGGACGTATTCCACAGGTCATGTTCGATGCAAAATAAGGCCGTGCACGTGGACACAGCCGCAACAGGAAGAGAGTAGTGGCTCACACGAGTTAGCCATATAGTATCGCGTGTTATGCGATTTTGTTTTACTATATTTGTACGCGTATTTTGGCTGTTACGTGTGTATTCCAACGCCATATTGTATATCGACATCTCCAATGGAGTTGCAATGTAGTTTTTTTTTATACATTTTAAGTCACATGAAATCATGAAACCCTAATTTCTGAAACCTAAAATCGAAATTTTCGCGACCTAAATCCTAATTTTTTTAGATAATACCAGAACAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGGGTCGACTACTACAAGGTCCTCGGTGTCGACCGCGGCGCCAGCGACGACGACCTCAAGAAGGCTTACCGCAAGCTCGCCATGCGGTGGCACCCCGACAAGAACCCCACCAACAAGAAGGAGGCCGAGGCCAAGTTCAAGCAGATCTCCGAGGCGTACGAGGTCCTTAGCGATCCCCAGAAACGCACAATCTATGACCAGCTAGGGGAAGAGGGGCTCAAGGGGCAGCCGCCCCCAGGTGCGGGAGGTCCTGGTGCATCTTCCTTCTATCCCGGTGGGGCCCAGTCCACCTCATTCCACTTTAATCCGAGGAGTGCAGATGACATATTTGCCGAATTTTTCGGATTCCCTGGCCCTTTCTCTGGTATGGGTGGCGTGGCGGGTGGAACTGGCAGCATGAGAGGGGCCCCAAGATTCCATGGGTCTATGTTTGGAAATGAGTTCTTCTCTTCACGCTTTGGCGGGGAGAGTTCTGCTAGTAGTATGGCACGGCCATTACACAAACCGGCCCCTATTGAGAATCGGCTTCCAGTTAGCCTTGCAGATTTATACAAGGGTGTAACCAAAAAGATGAAAATCTCAAGAGAGATTATAGATGCCAGCGGTATTCCATTTTCTGAGGCATCTATTCTTGGCCCTATTCGATCCTGTTGCTTTTATGCCAATGAAGAGGGGAACGGACAAAAGCAGTTATACCATGTGACAGATGGGTCATCCCTGTTGGTGCAGTCCAGACCACGCCAAGCAGATATTCTTGTAAAGTGTTGTTCATGTGACATTCTAGCTAAAGACAGGAGAGTCTCACAGGTAGAGGAAATTTTGACAATAGATGTAAAGCCTGGTTGGAAGAAGGGGACGAAGATCACTTTTCCTGAAAAGGGGAATGAAGCTCCAAACATGACACCTGCTGATATTGTTTTCATCATTGAAGAGAAGCCCCATGATGTTTTCGCTAGGGAAGGAAATGATCTTGTCATGACAGAGAAAATCACTTTGCTCGAAGCACTGACAGACTATACCGTGCGTGCCGCTACACTTGATGGGCGGAGTCTGTCGGTGCTCGTTACTTCAGTAATCCATCCTAGCTATGAAGAGGTGGTCACTGGAGAGGGCATGCCTATACCTAAGGAGCCCAACAAGAAGGGCAATCTGCGGGTTAAGTTCAACATCAAGTTCCCTTCCAGGCTGACCTCTGATCAAAAAGTTGGCATCAAAAGGCTTTTGGGTTCTTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000667G0420 gene.
TTAAAGAACTTCCGAACAATCTTCACATATAAGAAACGAAATCCCAACCTTGCTGTGAACTTGTGACCGAAGGGAAGCCAAGCAGCCAGCCGAGCTCGGGAAGACGCCGCGCCGGGATAGCGTTGTCGTCTCGCTGGCCGTCGCGGCGTACGCTAGAGAGCTACGAGAGCCCACGATTACACGATCAGTACGTGAGTTTTGGCTACAATCAAGGGTTTGCATGTGTGCCACGATTACACGATCAGTACGTGGGTTTTGTCTACAATAAGGGTTTGCGTGTGTATGTGTGTGTATATATTAATATATACATATAGACAACATGTCTAGTGCTAATAGCTAATTGAGTGCTAAGGTGTTAATATCAACAAAAAGCAATATATTAATATATACATATAGACAACATATCTAGTGCTAATAGCTAATTGAGTGCTAAGGTGTTAATATCAACAAAAAGCATCAGATCTATCAGATCTAGATTGAATAGCCAAGATTAATGAGAGCTCCACCTCCAACCACTTAAACTTTTTTCACTATACACCCTTCATTTCACGTCCCCAATCCATGACCAATCGTCTTCCTCTCCTCTGACCCATCGCCTCCCTGGCCCCTGGGCCGCCGTCCAGCCCCCTCCGGATGGACAACGTGAAGAACTGCATCGTCATCGACCCGTACTACTGCCTCGGCAGCGGCTGCGCCAAGCAGACCTCGGTGGTGCGCGTCGCCGGCATCACCTACCGAGACATCCGCGGAACGTACAACCCTCAGGCCAGCCCACCGGTCCGCGAATTAATTGATATTTTGACACTACCAAAGATTGGCATTTGCTGATTTGACACTCATGTGTCTATAACATCAGGACCCAGATGTCATAGACACATAAGTGTCAAATCAGCAAATGTCAATCTTTGGTAGTGTTAAAATATCAAATCCCCCCGGTCCGCTTCGCATACAGCGACAGCATCGCCTGCACCGACATCACCATGACCGACGTCGAGCTTCTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000667 Download
Protein sequence
Protein sequence
MGVDYYKVLGVDRGASDDDLKKAYRKLAMRWHPDKNPTNKKEAEAKFKQISEAYEVLSDPQKRTIYDQLGEEGLKGQPPPGAGGPGASSFYPGGAQSTSFHFNPRSADDIFAEFFGFPGPFSGMGGVAGGTGSMRGAPRFHGSMFGNEFFSSRFGGESSASSMARPLHKPAPIENRLPVSLADLYKGVTKKMKISREIIDASGIPFSEASILGPIRSCCFYANEEGNGQKQLYHVTDGSSLLVQSRPRQADILVKCCSCDILAKDRRVSQVEEILTIDVKPGWKKGTKITFPEKGNEAPNMTPADIVFIIEEKPHDVFAREGNDLVMTEKITLLEALTDYTVRAATLDGRSLSVLVTSVIHPSYEEVVTGEGMPIPKEPNKKGNLRVKFNIKFPSRLTSDQKVGIKRLLGS
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above