gene PH01000630G0150
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000630:134192 - 135408(+ stand)   Name
Alternate name Locus tag PH01000630G0150
Length of gene 1217  bp Length of CDS 801  bp
Product information
Feature type
CDS
Product name
ZF-HD protein dimerisation region containing protein
Alternate name
Molecular weight
(predicted)
27626.9236199999  kDa
Isoeletric point
(predicted)
8.14381790161132
Length
266  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP03613040 PH01000630:134641 C C_A
PH01SNP03613050 PH01000630:134704 G G_A
PH01SNP03613060 PH01000630:134718 G G_C
Ortholog Groups (determined by OrthoMCL algorithm)
(0 result)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os04g35500.1 ZF-HD protein dimerisation region containing protein, expressed 1E-74
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 266
Detailed signature matches
    1. PF04770 (ZF-HD_dimer)
    2. PS51523 (ZF_HD_DIMER)
    1. SSF46689 (Homeodoma...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31948 (FAMILY N...)
  2. PTHR31948:SF0 (SUBF...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 218256 23 68 5.40E-24 pfam04770 ZF-HD_dimer cl04737 -
superfamily 243867 23 68 5.40E-24 cl04737 ZF-HD_dimer superfamily - -
specific 130628 158 214 1.47E-21 TIGR01565 homeo_ZF_HD cl11752 -
superfamily 130628 158 214 1.47E-21 cl11752 homeo_ZF_HD superfamily - -
non-specific 130629 23 68 1.98E-19 TIGR01566 ZF_HD_prot_N cl04737 -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000630G0150 gene.
ATCTCCTCATGCGTAGATAAAATTCAGATTTAATATTTGTTGTAGATCAAATTTAGATTTAATATTTATTGAACATAGATTGATTTTGTGTCAATGCTACTAAATTTTTTAGAATTATTTGCAATCGTTTGCACGTATTTGGAGGAGAGGAGTACGAAAGCTAAGGGGTGGAAAAGTAAGACACCCGCTGATCAACCAGATAGAGCAAGAGCCCGCTCGCGACCTGCCACACAGAGGCGACATGAAAGGGCCCACAGACGCGTGGCACAGAGGATCATGGGCAGGGGCCGTACCCCCACGGCCGCTTGGCAGTTAGCCCATACCTCACCACCCCACTCCGCCCGGTCCGTCCGATCGCATCACGGCCGTCCGCCCGTGCGGGCCCGCTGGCCCCATCTGACGCCGCACAGTACACCACCACCCCACGTGGTGGGCCCGTCCGCCCGCGCGGTAAGTGAGTACTATATGGATAGGTAAAGCAACGTAGTAATTACCGCCCCCAATGCCGGCTAGACACGTAGCCGCTGTTACCGCACCTCGCCTCGTCCCGTCGGCCTCCCCGGCTCACGTGGCGCGCGCAGGCCCGAGAGGCCGAGAGGCCTCTCCTCCGCCCGCCACCTGTCACCGCGCGAACGTGGCCTTGCCGCCTAGGCAAGGCAAAGCAAAGCAAAGCAGCCTCGCCTCTTGCATTCATGCGTGAGGAGAACGAGTCAAATTTGCTTAAGCAGCTGTCAGTTTTACGACATTTTTCTACAGCATTGCATTTGCAAAGTTAATTAAGCGAGCGCTGTGCAAACATGGGAAGCATCCAGGGGTAAAAAAGTAACTTCATGTAGTGGCAACTGTCTTCTAGTAGTAGTAACTACCTGGTACAATTAATTAATGAGCTCACTGTTTTCTGTCTCTCGTTCAAACTCGTTGCATTAATTAACCGACTAATTAATCCCTCGCACCTGATGGTGATTGGTGAGTGATGACTGAGCAGCGTCGTCGCCACGCGC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGATGGATCACCTGAGCCTGGTGCCCTACGAGGGAGGCAGCGGCGGCGGGGCCGGGGGCTGCGGGAAGTACAAGGAATGCATGCGCAACCACGCGGCGGCCATGGGCGGGCAGGCGTTCGACGGCTGCGGGGAGTACATGCCGGCCTCGCCGGACTCGCTCAAGTGCGCCGCGTGCGGCTGCCACCGCAGTTTCCACCGCCGCGCGGCGGCGGCCGGTGGCCCCGGGGCTTGCGCGCCCGTCTTCTTCCGCCCGCCGCCGCCGCCCCCGCACGGGACGCACCACGCCGCGCTCCAGGCCTTCCTTCCGTCCGTGCCCCCGCCGCCGCCGCAGCTCGCGCTGCCGTACCACGCCGTGCCTGCCACAGCGTGGCACCACGCGGTGGGGGCCGCGCGGGCCGGGTCGGAGACGCCGCCTCGACCGGAGGACTTCGCCGGCGGCGGGAGTGGGAGTGGGAGCGGCAGCTTCGGGCGGAAGCGGTCCAGGACCAAGTTCACCTCGGAGCAGAAGGAGAGGATGCGCGAGTTCGCCGAGAAGCAGGGGTGGCGCATCAACCGCAACGACGACGGCGCCCTCGAGCGCTTCTGCATCGAGATCGGCGTCAAGCGCCACGTCCTCAAGGTCTGGATGCACAACCACAAGAACCACCTCGCCTCCCCCAACTCCTCCGCCGCCGCAGCCGCCGCCGGCATCAACCCCAGCGCCGGCGCCGGCACAGGAGACGGCGACGACGACGACACCGACGACTTCCCTCCCCACGCTGCCGTCTCGTCCCCCTCCCCGTCCCCCATCAGCGTCTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000630G0150 gene.
AAAAAATTCATCGGGAGAGCTGCCATCCCCTATCCGCGGTCCATCCAGGGTGATTGGAGGCGGATCAACGGCCATGTAGGAGGGCTTCCTCAGCAAATTTGCTTCCGCCATCTTAACACACGTTTAGATAGATGTAGGCCAGCACAAGTGTGCCATCCTAACACATGTTTAGACAGACGTAGCCCGCGATAAATACGACAAATCTCGCAAAATTTCTACTTAAACATGACTCGCACAACGTACGTCTGAGTTGAACACCGGTGATGTGGGGACGTACACATACAAATTTATCAGCAATACAAGAGTTGGTTCCTTGTATTGTCTTTTCTTAATCGCAGCACCGGTGATTTGGAGTCTACACCTGTAACTCCATTGACAATACAAGAGTTGGTTTCTTAATCGTACTAGCTGTAGGGGCTAATCATCGTATTACTTCTTACTACTACTAGTTTATTAAGACTCACGTTGCCCGTGGCTTTGGGGTTAGTGCCTGGAAGCTTCCAATTGATTGGTCTGCGCCGAGATTTGTTAAGATCTCGCTTGCCTGCGTCGTGTGTATCGCTGCCGCTACTAATTGCATGGCCTTTCTTTGGTCGCACTCGTTGTTGGAATTAGATTAATGGAGCAGTGATCGTATGCGCCGTAAACTGTTTTAACTTTTAACCTCGCGATTCGTGCCGTGCGTCGTGGAAGTTTCGAATGGAGGGTGGTGGGGGTGGCCTGAGATTTTGTTGCCATTTGCGCCCTCCCTCCCAGCCGGCCGGACCACGCTTCGGCCGTGCGGTGGCTGGCTGGCGACCACGCGGCGGTGGTGGAGCCGGAGCCGAGCTGAGCTCCCTGCCCATTGCTAGCTTTTTTGTTGTTTGGTTGTTGCGCTGCTGTTCCCCCTCTTTCCTTCTATCTTTTCTGCCGTTTGTGGGTGTGGGGTTAAAATTGTGTCGCGTCCGTCGCGAGTTGTCTTTTCGGCGTCGTTGTGTCGCGCGGCCGGCCGGCCGGCCGGC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000630 Download
Protein sequence
Protein sequence
MMDHLSLVPYEGGSGGGAGGCGKYKECMRNHAAAMGGQAFDGCGEYMPASPDSLKCAACGCHRSFHRRAAAAGGPGACAPVFFRPPPPPPHGTHHAALQAFLPSVPPPPPQLALPYHAVPATAWHHAVGAARAGSETPPRPEDFAGGGSGSGSGSFGRKRSRTKFTSEQKERMREFAEKQGWRINRNDDGALERFCIEIGVKRHVLKVWMHNHKNHLASPNSSAAAAAAGINPSAGAGTGDGDDDDTDDFPPHAAVSSPSPSPISV
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above