gene PH01000573G0670
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000573:459429 - 460327(+ stand)   Name
Alternate name Locus tag PH01000573G0670
Length of gene 899  bp Length of CDS 615  bp
Product information
Feature type
CDS
Product name
AP2 domain containing protein
Alternate name
Molecular weight
(predicted)
21361.1652199999  kDa
Isoeletric point
(predicted)
9.24264144897461
Length
205  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP03361850 PH01000573:459596 G G_T
PH01SNP03361860 PH01000573:459647 C C_T
PH01SNP03361870 PH01000573:459949 T T_C
Ortholog Groups (determined by OrthoMCL algorithm)
(0 result)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 20 40 60 80 100 120 140 160 180 205
Detailed signature matches
    1. SSF54171 (DNA-bindi...)
    1. PF00847 (AP2)
    2. PR00367 (ETHRSPELEMNT)
    3. SM00380 (AP2)
    4. PS51032 (AP2_ERF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31677 (FAMILY N...)
  2. PTHR31677:SF0 (SUBF...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0003677 DNA binding
GO:0003700 sequence-specific DNA binding transcription factor activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 237985 23 83 3.66E-13 cd00018 AP2 cl00033 -
superfamily 241562 23 83 3.66E-13 cl00033 AP2 superfamily - -
non-specific 197689 24 81 8.95E-15 smart00380 AP2 cl00033 -
non-specific 216148 23 56 1.01E-06 pfam00847 AP2 cl00033 C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site R26,G27,R29,R31,W33,R35,E39,R41,R48,W50,T53 11 11 237985
 
DNA sequence
Upstream 1000 bp region from PH01000573G0670 gene.
AAAACACATAATATATTGTTATGTCAATTCTCCTCAAAGAAGAAGCACGTTAATAGCCTATACTTTTGACATCTTTCTCAAAGCTTGACTCATCAATGTATCAATGCTTGACTCATCAATTTAGTATATACAACGTTTTTTTAATCAGATTATATAAACAATGTTAGTTTGTGCTCTTAGTTGTGCTCTAATTTTTAGTTGAAACTGTCAGTTTTATGTACATAGGTTGATGAATATGCTTCCACTAGTTGAGGAATGGAGCAATGGAGATGGAAGTGCTGTCATTTTGGAGGAATGGAAATGCTGCTATTTTGGATTGCCAATTTGCCATTTGTGTTGCACTGTTGCCATTTTATTTGCTTTAATTCAGAACTTGTTAGTTGATTTGTAATGTTGGATTGGCATATGGCTACTGCTGTTGTGTGTGTCCTGGCGAAATTTCCTCCTGCTGCTGTTGCCGAAATTTCCAAATTTCGGCCAAATTTCAAATGCTGATTTTGACCTTTTGGACGAATTGAAAATGAAATATTCGAAATTTCGCCAATTTCGGTGGGTCCCGAATTTTTTAGCAAAACGAAATACGAAACCTTTGCCGGAAGCTTCTTTTCAAAAAAAGTTCAAACGTACCAAACAAACCCTTAGTGCGGCGAGCTGGTTTCACCGATGATTTCATTGGAGGGGGCACGTTTGGTTTCGAAACCAAATATTGATGACACCCATGAAATTTGTCTGTAGTCTGATTTGCTACTAATTTTCAATAATACTTGCGAAAATTTAATAACACCAAAAAATCTAACACGAGAAGAATCGGAGTGAGAGGAAATCGCGTACACCGACTCGCCGCATCACATGTGAGAGCCACGATTCACACGCACCGCGTCCCATCGCGGAAACCGACGCCAAGAGCCGCCCAAACGCGGGGGCGGTGGCCCGGCCCCACCACGCCTCCCGCTCCGCCACCTCCCCTGTATATTTATTGGCGCGCCTCACCTCACCTCTCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGCCCAAGAACCAGTCGCCGGCCGACGCGGCAGGCAATGGCGGCGGTGGCCGCGAGATGGAGCCGAGGCTCCGCGGCGTGCGGAAGCGGCCGTGGGGCCGGTACGCGGCGGAGATCCGCGACCCGGTCAGGAAGGCGCGCGTCTGGCTGGGGACGTTCGACACGGCCGAGGAGGCCGCGCGGGCCTACGACGCCGCCGCGCGCCGGATCCGCGGGCACGCCGCCAGGACCAACTTCCCCGCCGACCAGGCCTGCGCCGCGCCGCCATCGAAGGAGGCGGCGAGCGCGAGTGGCAGCACGGTAGAGTCGTCGTCGTCGTCCCGTGACTCGCCGGCGATGGCGCCCGCGTCGCTGGGTTTGAGGCTGGGGATGCCGGCGATGGTGGCCGCGCAGCCGTACCTGTTCGTGGACCCGAGGCTGGTGGTCACCGTGGCCGTCCCGGCGCCAGCACCGTTCGTGCCGCCGAGCAGCCGGCATGAGGCGGCCGTGGCGACCAAGAAGGCGTGGGAGGACGCGCAGAGCGACACGTCGTCGTCGTCGTTGGTGGACGCGGCGCCGGCGGTGGGCGTGGGGTTCGACCTCAACCTGCCACCGCCGGCCGAGATGGTGATG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000573G0670 gene.
AAAAGAGAAAATTTGTGGTCTGCAACAAAATGGAGTACTACTGCCTTGCATCACAAAAAAGATGCTTAATTTCAGTTTAATGGAGCACAATACTATCACGAGAACGGAAACACATCATCCGACATTGTATATCGTAATATTGCGTAGTAGATGTTGGATCGAAAAGGAAAAGATCAGATCGTGTTTCACAATTGCAGCAAAAATACTGCCGCATCGATGCTATTCGTGAATACTGTAGCGGTTGATCTGAGCTGTTCTTCCTGGTTTCAAGAGCTCAAATCTACTGGCACTGCGCTCCTTTGATGCCAATCCCGCCGCCCTCACCTCCGCACCGCTCGTTCTCCCGCCGCCTCCCTCTCGCCCAGCCCACCTCGCCTCCACCTTGCTCGTTGTCTCCTGCCGCCTCCCCCTCGCCCCGCTCCACCCGTCGCCTCTCCCTCGTCCCGCTCGTTGTCTCCAACTCCGTCGCCGCCCTCGATATCCTCCACGTGTGACTCCCGTACTCTCATCCCGTCGTTCTCCATGCGCTCGCGCGAGTCGCGCCACGCCGCCCCTCGCGATTCCTCTTAGAGAGTGGGCGGCGGAAGCTTCCTCGACGGCGGTGCTCCTTGGTGAATGGTGGCCCTGTGCCGTCCCGGCGCCCTTCGTGACCCCCTCTTCCACAGCCGATAGGAGCTTCCTCGGCGACGCACGGTGCGCCCTTTTGTTCATGGATAAACGCTCATCGCATCCTCTCTTCCACATCCGGCGAGGAACTTCCTTGGTGACGGTGAATCCCGGGTGGTCCTGGTCCTGGAACCAATTCCACATCCGCACCAATCCCCACCTAAATCAAAATCAAGCTGGTTGTTGGTTTTCATAGATATCAGTTTAGTGTGTTCGTAGATGTGGTTCATGTGGATGATGTTTTTGGGTTGCGAATTGTGATCGGTGTTTTGTAGGCGCGGATGATGTTTCTCTTCATATGAATAAGAGTTCCATGTTTTTCATATTGGATCGAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000573 Download
Protein sequence
Protein sequence
MAPKNQSPADAAGNGGGGREMEPRLRGVRKRPWGRYAAEIRDPVRKARVWLGTFDTAEEAARAYDAAARRIRGHAARTNFPADQACAAPPSKEAASASGSTVESSSSSRDSPAMAPASLGLRLGMPAMVAAQPYLFVDPRLVVTVAVPAPAPFVPPSSRHEAAVATKKAWEDAQSDTSSSSLVDAAPAVGVGFDLNLPPPAEMVM
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above