gene PH01000496G0570
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000496:377970 - 379918(+ stand)   Name
Alternate name Locus tag PH01000496G0570
Length of gene 1949  bp Length of CDS 621  bp
Product information
Feature type
CDS
Product name
homeobox associated leucine zipper
Alternate name
Molecular weight
(predicted)
23203.8657199999  kDa
Isoeletric point
(predicted)
5.25862503051757
Length
206  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP02952740 PH01000496:377990 C C_G
PH01SNP02952750 PH01000496:378002 G G_A
PH01SNP02952760 PH01000496:378038 A A_G
PH01SNP02952770 PH01000496:378153 G G_T
PH01SNP02952780 PH01000496:378166 G G_A
PH01SNP02952790 PH01000496:378197 G G_A
PH01SNP02952800 PH01000496:378220 G G_A
PH01SNP02952810 PH01000496:378244 A A_G
PH01SNP02952820 PH01000496:378278 G G_A
PH01SNP02952830 PH01000496:379379 T T_C
PH01SNP02952840 PH01000496:379597 A A_G
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_156025 6
Please click OG5_156025 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os02g43330.1 homeobox associated leucine zipper, putative, expressed 2E-92
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 180 206
Detailed signature matches
    1. SSF46689 (Homeodoma...)
    1. PS50071 (HOMEOBOX_2)
    2. PF00046 (Homeobox)
    3. SM00389 (HOX)
    1. PF02183 (HALZ)
    1. PR00031 (HTHREPRESSR)
    1. PS00027 (HOMEOBOX_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR24326 (FAMILY N...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0000976 transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003700 sequence-specific DNA binding transcription factor activity
GO:0043565 sequence-specific DNA binding

Cellular Component

GO:0005634 nucleus

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238039 23 80 1.16E-15 cd00086 homeodomain cl00084 -
superfamily 241599 23 80 1.16E-15 cl00084 homeodomain superfamily - -
non-specific 200956 23 77 2.79E-16 pfam00046 Homeobox cl00084 -
non-specific 197696 21 77 1.57E-15 smart00389 HOX cl00084 -
specific 202143 79 123 4.65E-10 pfam02183 HALZ cl02577 -
superfamily 207657 79 123 4.65E-10 cl02577 HALZ superfamily - -
non-specific 203350 50 75 0.00130874 pfam05920 Homeobox_KN cl00084 N
multi-dom 227863 23 80 6.84E-08 COG5576 COG5576 - NC
multi-dom 225471 34 123 0.00122615 COG2919 COG2919 - C
multi-dom 223496 13 126 0.00381933 COG0419 SbcC - NC
multi-dom 233757 22 131 0.00582963 TIGR02168 SMC_prok_B - NC
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific specific DNA base contacts R23,R26,I67,Q70,N71,A74 6 6 238039
specific DNA binding site R23,K24,R25,F27,K45,K51,Q64,A66,I67,Q70,N71,R73,A74,R75,R77,S78 18 16 238039
 
DNA sequence
Upstream 1000 bp region from PH01000496G0570 gene.
ACCAAATTTTGAGCCATTAGATCTTATATGGGCCGATCGGACCATGCTCTAAGCCGTTGGATCGTTTTAGCTGTATGAGCCGTTAGATCTTAGCTGTGCCGATTGGACTGCCTTCCAAGCCGTTGGATTTCCTTAAGGCTGAAGCGTTTTCCTCCGTTTCAATCTTCCTTACATCGTTGATCTTAAAGTCGATCGAATGGCTCTTGTTGAGTTTCATAATTACTGTGCGTCTTTATATTGTCGTTGGTGACTGAAGCTCGGTTGTTTTACTCTTTCGTTCTTACTTTTGCTGTAACAAAACTTGTGGTACTCCCTGGCTATTTAGTCCAGTGGAGACGCAATGAGAAGGACACGAAAAAGCATATTCGTAATTAGCCTTCAGACCACAAGGATCCCACCACATGCAGCCGTGTGACCTTGGCATCTTTTTTCAGCATCAGTGACCCGGAGCATCGTTCCTCTCCTGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTCAATAATCAATGCTCTGATCTTTCTTGGTTTTTGCAGTAAATTCGTGCGATCGATGAGTAAGAGTATTCAATAATTGATATGGATCAAGAATTGTTTATGTACAGAGTTGGTACCTGTGGGCTGTGGCATGTGCATGATCAGAACTTAGAACTGAAAATTAGAAGAGACAAAAGAAGGGAGAGTAGATAGAGATTGAAACGTAGGCCTGTAGTGTCTACTAAGGTGGGCGTCGGCACGGCGCCATCGGAGAATTGAGGCCACAGGATTAGTCGGTCTTCACCGAAANNNNNNNNNNCGCCGTCGCCGGCGCCGGCGCGGGCTCAAATCAATCTCGAGACGGATAACCATTCCGTGCGTGGTCAGCAACGCGATGCGGAACACCTGGCGCGCGGCGAAAAGCGATCGAGGGCCCACATGCTCTGGTTAGAAAGCGCGGTGTGCCACGTGTGGGCATCGCGCCGGCTCGACCCGTGCGCCGCGCGCCG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGAAAGCGACTGCCAATTCTTGATGGTGCCACCGCAGCTGCACCAGGGCGCCGGAGGCGGGGAGAGGAAGCGCCGGTTCACGGAGGAGCAGGTGCGGTCGCTGGAGACCACGTTCCACGCGCGGCGCGCCAAGCTGGAGCCGCGGGAGAAGGCGGAGCTGGCGCGGGAGCTGGGGCTGCAGCCGCGGCAGGTGGCCATCTGGTTCCAGAACAAGCGCGCCCGGTGGCGCTCAAAGCAGCTCGAGCAGGACTACGCCGCGCTCCGCGCCCAGTACGACGCCCTCCACGCCCGAGTTGAGTCGCTTAAGCAGGAGAAGCTCACCCTCGCCACGCAGTTGGAAGATGTGAGGGCGAAGCTGAACGAGCGGCAAGACCAGAGCGGCGGCTGCGGCGGCGCTGAGGGGGACGACAAGAGGAATAACGTTAGCAGCTGCCTCGTGGAGGACAATAAGGGCGCGGCGCCGGTGGTGGACGTCTCGGAGGACTCTGCGGCGGACGGGTACGAGTACGACCACCTCGCGTACGGGGGTGGCCTACCGGAGCCGTTCTGCGCCACTCCGGAGCTGTGGGAGACATGGCCGCTGGTGGAGTGGAACGCAGTAGCGTGTCAATCAACGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000496G0570 gene.
ATAAAATTCTATTACATTTTTAATATTTAATTTGATTGTCTCATTTTTTAAATTTCATGTCTACTTCTGAATTCTACACATTTTTCTAATTTTTCTGCATTTTTTTTGAATTTTTTCCTTGGACAAACGGACCACATTTAGTCCGATGGATTAAACAGGCCGTGCTGACCCAGCACTCCGGCCCGGTACAAATAGTAGCCGGGCCAGAATGGGCCAGGCCGCCGTTTGGCCAGCTCTTGACACGGACACGGGCACAGGCACACCACCCACCACCCACCGAAAGAAGACGCAACCACTGGCCCGCCGTCGGTCTCCGGTTGGCGCCCCCTCCATCCGCCGGGATCCACATCCACAGTCGCCGTGTCTCGGCCTCTCCAAACCTAGCGCCGCCGACTCAATCAACCAAATCCGGCGACCTCCTCGGGCTTCTCTCCCCTCAACTACCTCCATCCGCCGCCTACCTCACCCGCCACCGACAACCCTAACCCGATGGGTCGTCTTCCCCGGCTTCGGTTTGGGGGGGGGTGCTCCACCGTCTCCAACGACGATGACGCCGGACACCAACGAGCCACCGCATCCATGACTACAGCGAGCTTTCATAACTATCTGTTCTACCCCGTTCTAGCAATGTGTCAGATAAGTGACACCCTACTCTTCCCTTCTACTACTACTGGATTCTACCAATGTGTCAGATAAGCCAATAGAAATCAATCAATCACATACCGCAATGTGTATTGTTCCATGGAGAAGCTAGTGTTAGTATTTGATAGATGAGTTCATATGTGATGTTCTGTTGTAAATTTGGGATGTCCAAGTATTCTAGCATGATCAGGGCGACTTATCTCATCAGTTCATCGATAGTGTAGTACTCGCTCCGTTTTTCAATGGTTGACGTTTGGAGAGATTGAGAAAGTTCAAAAAAGCTTGACGTTTAGGGTGTCCGAACGGTTTTCTTCCGCTTTTGCCCCTGACGAGTCCTTCAGTATACTTTGGCTCGAACC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000496 Download
Protein sequence
Protein sequence
MESDCQFLMVPPQLHQGAGGGERKRRFTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQLEQDYAALRAQYDALHARVESLKQEKLTLATQLEDVRAKLNERQDQSGGCGGAEGDDKRNNVSSCLVEDNKGAAPVVDVSEDSAADGYEYDHLAYGGGLPEPFCATPELWETWPLVEWNAVACQST
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above