gene PH01000417G0950
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000417:552619 - 560925(+ stand)   Name
Alternate name Locus tag PH01000417G0950
Length of gene 8307  bp Length of CDS 1755  bp
Product information
Feature type
CDS
Product name
rab geranylgeranyl transferase like protein
Alternate name
Molecular weight
(predicted)
66420.2998200002  kDa
Isoeletric point
(predicted)
5.55305099487304
Length
584  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_128238 3
Please click OG5_128238 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Repeat
1 100 200 300 400 500 584
Detailed signature matches
    1. PF01239 (PPTA)
    2. PS51147 (PFTA)
    1. PF12799 (LRR_4)
    1. PS51450 (LRR)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF13516 (LRR_6)
  2. PTHR11129 (PROTEIN ...)
  3. PTHR11129:SF2 (RAB ...)
  4. SM00365 (LRR_SD22)
  5. SSF48439 (Protein p...)
  6. SSF52058 (L domain-...)
GO term prediction

Biological Process

GO:0018342 protein prenylation

Molecular Function

GO:0005515 protein binding
GO:0008318 protein prenyltransferase activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 238064 362 499 6.74E-06 cd00116 LRR_RI cl15309 N
superfamily 246925 362 499 6.74E-06 cl15309 LRR_RI superfamily - N
specific 201678 166 189 0.000345669 pfam01239 PPTA cl03138 C
superfamily 201678 166 189 0.000345669 cl03138 PPTA superfamily - C
non-specific 238064 362 499 0.000794098 cd00116 LRR_RI cl15309 N
specific 201678 95 122 0.000905461 pfam01239 PPTA cl03138 -
superfamily 201678 95 122 0.000905461 cl03138 PPTA superfamily - -
non-specific 238064 342 582 0.00412399 cd00116 LRR_RI cl15309 -
non-specific 238064 362 494 0.00604201 cd00116 LRR_RI cl15309 N
multi-dom 206026 359 416 0.00708832 pfam13855 LRR_8 - -
multi-dom 206026 440 497 0.00708832 pfam13855 LRR_8 - -
multi-dom 227823 46 188 1.55E-26 COG5536 BET4 - C
multi-dom 215423 43 188 4.09E-18 PLN02789 PLN02789 - C
multi-dom 227223 362 497 1.38E-07 COG4886 COG4886 - NC
multi-dom 227223 346 497 3.00E-06 COG4886 COG4886 - NC
multi-dom 227823 57 185 8.84E-06 COG5536 BET4 - NC
multi-dom 205079 360 398 0.000105052 pfam12799 LRR_4 - -
multi-dom 205079 441 479 0.000105052 pfam12799 LRR_4 - -
multi-dom 227223 360 534 0.000162238 COG4886 COG4886 - N
multi-dom 205079 379 416 0.00416086 pfam12799 LRR_4 - C
multi-dom 205079 460 497 0.00416086 pfam12799 LRR_4 - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic Substrate binding site N385,F413,K469,D491,S493 10 5 238064
generic Leucine-rich repeats L378,L381,C383,L386,K388,L406,L409,L411,N414,I416,L438,L443,L445,N448,L450,L462,L465,L467,N470,I472,L487,L490,L492,N495,I497 59 25 238064
 
DNA sequence
Upstream 1000 bp region from PH01000417G0950 gene.
ACATAAATAAAATACTTTAGATATTAGAACATAACTTGCTATTATAAATACGAGAATATAAACCTTGCAGGACTCATCATAAGAATTTAATGCTTTGCTCTCCTAAAGCTTACAACCATTATTCAAAGAATAAAATAATTCAATGTTCTGCTTCAATCACAAACTGCAAGTGACTGTAAAAAGATCTAAGTGCAATGCGTGCACCAGATCGAATGAGCAAAGTATTCAGAAACTTCTGCCTCAATCTGCTTTATGGCGATCTTCTCCTCTTGGGCAACTACGGCTGCGGCTGCTGCGATGTCCAAAGGAGGGATGATGGGGGCTGCTACTGGGCTGTCCACATCCATGAGTGCAACTAATGGTTGTGGACCCTTTGTGTCTGCAATGGCGAGGTGTGCCTCATGCTGTCTTTTGCCCTTTTTCTTAGACAATAAAATATCAATAACATGCGACCTATGACCTTACCCTTCTTGCCCCTCTCCTTCGTGAGATGTTTCATCACCTTATAGCTGCTAGCATTGGCTTCATGGCCAACATTGCTACTAGGCGGCTATGAGATGAAATTCTTTCTTAGACCATCATCTTGAGCTTTCGCAACTTGCATGATGTCAATTGATTCGGCATACTCCTTGTAGCTGTCTTGACGATAGTTGCGTGCAGATGGCACCGCATTCAGGTGAAAGGTAGAGAGGGTCTGCTTAATCTTTTGCTCATCCGTGATTATCTTACCACAAAGTTGAAGATTGGTACAAATTCTGGCCATGCTGGGCCAGCTCTTCAAACTCCCGGTTCGTGATGCTAGTCATCTACATATTTATGCAAAGAGTTCATAAGCTTACTGCTGGTAATTTGCGTAAAATAGTTGTAAAATTCTCATAATGCTCCTTGAACTCCTGGTTCGTGATCCTGTATTTTTCTATGCATTTTTCATGATTTACTGCTATTTGTAGTGATTAAAAGCAATATAAACAATCACATATAATCAAAACAGCAAATACAAT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCCGGCGCTGGCGCGACATGGCTGGTGCAGTGGTGCGGCTCTAGATCGGCATGTGCATGCTTGCCGCGTGCTAGCGGGCGTGGCTCTGTCGTTTCCTTCGTAGCGATGTATGGTGGTGGACTAGCCGACCGGTACACCAAGGAGGCACTCGGGCTAAGCTTCAAGCTGCTCGAGATGAATCCAGAGGCATACACCGCGTGGAACTACTGGAAGCTTGCACTTCAGCACAACCTCAGGGAGCTTTCTGACCCGGAGTCCGCCAAGTCTGCTGTTGATGGTGAGTTCAGAGTAGTAGAGATTGCTTTAAAGCAGAATCCAAAGTCCTATGGGGCTTGGTATCACCGGAAGTGGTTGCTAAACCAAAAGCTTGCCCCAGTGGATTTCAAGCGTGAGTTTGGCCTCTTGGATAAACTATTAAAGGTAGATGCGAGGAATTTCCATGGATGGAACTATCACAGCTTCCTTGCAACATCCATGGGGGTGCCAGAAGAGGAAGAGCTCAAGTACACGATGGATAAGATCAGCGACAACTTCAGTAATAACTCAGCGTGGCATAATCGTAGAAGTGGCTCTCACTACAGTTGTCCTGTGCATTTCGCATTTACTGTTGAACTGTGCAACAATGATGATACACCCCAGGATATTGATCTGCTTCATGGCCCATTCTCCTGGGATTTCTCAGAACCATTACAGTCTCATGGAAAACCTATTTACATCCCCTTTGATCAGCTAAAGATCACTGATGCCTTAGTTCAAGAGGATTCAAAATGGCATTTGGAAAGACTATCTGATGAAATAAACCTTTTCAGAGAATTGCCTGATGAGAATAGGAAGGAATACTGTGAAGAGGCACTTGGGCTCTTCAGTGACTTGATTTACCTAGATCCATCTCATAAAAGGTACTACGCCGATGAGAGGAGCTTAGCCCTAATGGATCAGTTAACATGCAACATGGAGACTTTTATTAAGTACTGTTCAGTTCAAGTTCAACCAAATTTAGGTCCGTTAAACCATGTGCAACTTTGCAGGTTGTCTTTAACACGCATTGGATTTGCTGAACGTTTGTTGTGGGTTCAAATGCTGGACCTAAGCCTTAACAGTCTCAGATCAGTTGAAGGTTTGGAGGCTTTGCAGCAGCTTGTATGCTTGAACCTCAGCAAAAACCAGATCAGTAGTTTCACAGCACTTGAACCCCTTATGAAGATAATTTCTTTGAAAGTCCTGGATCTATCTTTCAATGAGATTGGAGCTCACTCGATTGACACAACACGGTTGTCTTTAACACGCATTGGATTTGCTGAACGTTTGTTGTGGGTTCAAATGCTGGACCTAAGCCTTAACAGTCTCAGATCAGTTGAAGGTTTGGAGGCTTTGCAGCAGCTTGTATGCTTGAACCTCAGCAAAAACCAGATCAGTAGTTTCACAGCACTTGAACCCCTTATGAAGATAATTTCTTTGAAAGTCCTGGATCTATCTTTCAATGAGATTGGAGCTCACTCGATTGACACAACACGGTACATCTGCTCATCTCCATTTTCACACACAGTCGAAGCACTTGAAGCTGTTGAAGAGTGCCAGAAGACAAATCTCAATGTGGAGGAATACTGGGAGGCCGTACTGTTATTCAAATGTGTGAAATTGGCACGGCTTGAGATTAAAGGAAATGCAGTTGCCGACAAGGACGACTTCAGAACTCTTGTGATGGCACTCGTTCCTTCTCTAAAATGGCTTGATGTTTCATGTGCTCGTTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000417G0950 gene.
AAAAAGGATTATGTTACGTGAATACGAGCTGAAGAAATCTTTGCAGGATTAGCCTGCAAGAACAAAAGACTGCAACTCTTCGTGTAGTAGCATCTTCCTCATGTATAGAACTGCAGATGCAGCGGAGATCAGGATTCGAAGGACTGAAATTTCTTGGAATAAGCAGCGAAAGCTGTTTTTAGATGGCTGTGGCTTTTCTGAAAAGTGGCTTCTAGCTGTGCTGCAGGGCTGAACGGCAGGGCTGAATGGTTGGGCTGAAGAGATTTGCTGTTTAGTTGTCTGGCTTTTAAGTAGGCTGACTGCAGTTTCGGAGATGGAAAATGTCTGAAATGCATCCGAGAATAGTGATAGCTTGTTTGACGCACGACAAACGCAATTGACGACAACTACCGCAATTGATGGTGACGAGGATCTAATAATCCCAATTTAATTATTTATCTGTAATTCTTATTATAGATGGTAATATCTTTATATTGTTCGTAAGTACACCCCTTTACTGTTTATAACGGAGAAGTTTAACCGGGTGGTCGTAAGTCTTACTACGACCACCCTCCGGTCGTAAGCCTTTCTACAACCAAACTCTAGTCGTAAGCTCTTCTACGACTAGTCCTTGATTGTGAGTTTTCTACGAGCACCTTGTGGTCGTAAATATCTCTACAACATGGTCAGTTACGACCATCCTATAATCTATGGAGCCTACAAACATGTGGGTTTAGTTGATTAGAGAGTCTTACGCGTTGTGTTTAATGCACAGGGCAGTTAACATATACTGTTATTCTCTGTGAATAACTGCACGTTTTATGCCTGTCTCAGATAATAACTACTTGGCGACATGGGAGAGTTATTTCCCTGACAGTAACCTCTACCAACGGTTTATCACTTGGAACGTTGGGATGTCTCTTGGCTTGGAAGAACTGTCACCTCTTCATATGTTATATAAAGAATGAAGTCAGTAGGCAGAAGAAAGGGGCGATCAAGAGAGGCAATCTGGAGCACAAGAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000417 Download
Protein sequence
Protein sequence
MAGAGATWLVQWCGSRSACACLPRASGRGSVVSFVAMYGGGLADRYTKEALGLSFKLLEMNPEAYTAWNYWKLALQHNLRELSDPESAKSAVDGEFRVVEIALKQNPKSYGAWYHRKWLLNQKLAPVDFKREFGLLDKLLKVDARNFHGWNYHSFLATSMGVPEEEELKYTMDKISDNFSNNSAWHNRRSGSHYSCPVHFAFTVELCNNDDTPQDIDLLHGPFSWDFSEPLQSHGKPIYIPFDQLKITDALVQEDSKWHLERLSDEINLFRELPDENRKEYCEEALGLFSDLIYLDPSHKRYYADERSLALMDQLTCNMETFIKYCSVQVQPNLGPLNHVQLCRLSLTRIGFAERLLWVQMLDLSLNSLRSVEGLEALQQLVCLNLSKNQISSFTALEPLMKIISLKVLDLSFNEIGAHSIDTTRLSLTRIGFAERLLWVQMLDLSLNSLRSVEGLEALQQLVCLNLSKNQISSFTALEPLMKIISLKVLDLSFNEIGAHSIDTTRYICSSPFSHTVEALEAVEECQKTNLNVEEYWEAVLLFKCVKLARLEIKGNAVADKDDFRTLVMALVPSLKWLDVSCAR
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above