gene PH01000383G0320
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000383:261198 - 262763(- stand)   Name
Alternate name Locus tag PH01000383G0320
Length of gene 1566  bp Length of CDS 324  bp
Product information
Feature type
CDS
Product name
MYB family transcription factor
Alternate name
Molecular weight
(predicted)
12671.80852  kDa
Isoeletric point
(predicted)
9.55965805053711
Length
107  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_164233 3
Please click OG5_164233 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT1G01060.4
Homeodomain-like superfamily protein
LHY encodes a myb-related putative transcription factor involved in circadian rhythm along with another myb transcription factor CCA1
LATE ELONGATED HYPOCOTYL (LHY); CONTAINS InterPro DOMAIN/s: SANT, DNA-binding (InterPro:IPR001005), Myb, DNA-binding (InterPro:IPR014778), Homeodomain-like (InterPro:IPR009057), Myb-like DNA-binding domain, SHAQKYF class (InterPro:IPR006447), HTH transcri
4E-39
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 10 20 30 40 50 60 70 80 90 100 107
Detailed signature matches
    1. SSF46689 (Homeodoma...)
    1. PF00249 (Myb_DNA-bi...)
    2. SM00717 (SANT)
    1. PS51294 (HTH_MYB)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR12802 (SWI/SNF ...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003677 DNA binding
GO:0003682 chromatin binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238096 26 69 2.19E-07 cd00167 SANT cl17250 -
superfamily 247804 26 69 2.19E-07 cl17250 SANT superfamily - -
non-specific 130620 22 72 7.64E-13 TIGR01557 myb_SHAQKYF cl17250 -
non-specific 215818 24 67 1.11E-09 pfam00249 Myb_DNA-binding cl17250 -
non-specific 197842 24 71 3.06E-08 smart00717 SANT cl17250 -
multi-dom 227584 7 60 0.00118979 COG5259 RSC8 - NC
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site W27,K56,T57,V59,Q60,R62,S63,H64,Q66,K67,F68 11 11 238096
 
DNA sequence
Upstream 1000 bp region from PH01000383G0320 gene.
TATGTACCAGTACCCACCCTCCCGGTTCACTCCCTCCCTAACTTCAAATCTGAAAAAAAAAAGAACTTCGAAAATTCTAAATGGCAGAAAATTTTTGGCAAGAAACTGGAACCAACTAACTTCACCACAACTTCCACCGTTGCTCCACCTGAGTGGACAGTGGATTTTTTTTTTCACTCACCCAGATCTCCTCTGCTCCACATAAATGTGAATTTGCTAAAGGTAAATATATTTAAGCACTATACGTATTGGCTAGATTAAAGGCTGTCACTTGTCACCCTCGCTTCTTATGAACCTAGACATAGGAAAAACATGTCTATTATTGGTGAGTACAAATGAGCAAAGCTATGTTTAGCAAAACTTTTAGTTGTGCTTTTTTGACGGGAAACTGTTAGTTGTGTAATATATTTGTATGTACAGGGCAGAGCTGTTCACCCCTTCATGACAATCGGTACGCTACACCAAGCAAGGACAGAGGGTCATGGCTGGTTGGCAGAGCATGAGTTTTGAGACCCAGAAAACCATCGTATTTTTTAAAATATTAACATTGTCCTTGTCCCCCATCCATAGATCTGGCAAGGAGACCCTTGAGAGGATGATGGTGCAATCTCAACAAGGCAGCATTTCAGTGGCTGTTGCAAGTTGATGGTAAATTGGTAATGTAGCCTCCATCAGGTGGCAGTGTGCAGCCCCCTAAAAGGCACAGGGCAGGGCAGCTTGAACAACAGGACAGACAACAGAAAGAAGAGGAGAGATAGAATGGGAGAAAATAAAAAAAGGAAATGACCGGGATACTTCTGTTTTTGGCTCATAAATAATAATTGTATAATATTAGCTTGATGTTTATCTTGATCAAATCCAGCCTTTCATGGAATTCTAATGGAAGGGTAAGATTTTTGGTCAATTTGCAACTTAATTGACAATATTTAATCTTTTTTTAATGGAGACATATGGAATACATTGTCAAAAGTTCTTCATACCTACACTGAAATAAGAGAAGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGAGATGAATTTTTCTGGTGAGGAAACGTTGATAAAGGTGAGAAAGCCTTACACAATCACAAAGCAGCGGGAGCGGTGGACTGAGGCAGAGCACAAACGATTCCTTGAAGCCTTGAAACTGTATGGCAGAGCTTGGCAGCGCATAGAAGAGCATGTTGGGACAAAGACGGCCGTGCAGATCAGAAGTCATGCTCAAAAGTTCTTCACCAAGGTTCTTTCTCTATCTTATTGGCTACTGCCCCTTGTTTGGTTTACTGCTATGATGCTATCTCCTCAGCTTTCTGGTTGCCTTGTCTTTAGCTTTGGTGATAAAAATGAATAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000383G0320 gene.
GCGAAACAATGCAACATGGCGCAACACAGCTTAAATATTCATTCACCCCTTTGAGAAATATAAAATTACACCCCCCAGCTCCATTTTAAAAAAAAAAATTTGCAGGTACTCAATGAAAAAAAATCATCATTCCTAAAATCAGGCATCAACTAATTAAGAAAACTAAAGAATACCACAATTACATGAATCGCGTGTTCTAAGAATCCCAGGAACAGCACCATTCCACTCACCTACAGAAAACCTTAATTGCAGATGTTCTGTTGCGCACAAAAACCGAGTCAGCAGAGTTTAACCTTTCTCCCTTCTTTATCTTCAACACTAGAATCAGATTAAAACTCGCAAGTTTTCAAATTATGCAACCATTCCAAAGAACAATTGGATTAGATTCACAAAACCAACCAAATGTATGGGGAAGCTGTGAAGCAATAAGACAAGAAGCAATCAAGCTCACCTGCTAAGGCCAAACACTTCCTCTAACCTGCCAGAACAATAAAATCCACATTATTAGTGCCTAATTCCTATCAACTTACAATTCATAACCAAAACCACCAAATCTAACAATGATTCTAGACCAATTGACAAATTTGGAACCTCAAATCTACCAAAAGCCGAAAAGATCATAACTACCTGAATAAACTGAGCTTTGAAGTTCCAGTACTTTGTTTGAATGGATATAGGTCAAAGAGTGGACCGTGAAGCACAAAAGCAGGCAGCACCAATGCATGACATTGCAGCTCCAAAATAATTAAATATGCCCCTGAACACTTCCTACACTTGGAGCTGCCGAAAAAAATATTGTGCTGTTATGAGACTAACAATCCGCATCACACAAAACCGCACATGAAACCAGCCTGCACTGTTTTAACTTTCATGGGACGCAAAAACGGTTTTAGAGTTAAGGGTGAAAATTAGACTCCAAAAAGGGTTCAGGGACCTAAAGTGGACTTTACCAACTTAAAATGATTTACGCATCCATGTACTAACCATGTGATACAGTTATT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000383 Download
Protein sequence
Protein sequence
MEMNFSGEETLIKVRKPYTITKQRERWTEAEHKRFLEALKLYGRAWQRIEEHVGTKTAVQIRSHAQKFFTKVLSLSYWLLPLVWFTAMMLSPQLSGCLVFSFGDKNE
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above