gene PH01000367G0730
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000367:548308 - 551538(- stand)   Name
Alternate name Locus tag PH01000367G0730
Length of gene 3231  bp Length of CDS 2649  bp
Product information
Feature type
CDS
Product name
disease resistance RPP8-like protein 3
Alternate name
Molecular weight
(predicted)
101033.40572  kDa
Isoeletric point
(predicted)
8.34884262084961
Length
882  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP02324190 PH01000367:549668 C C_T
PH01SNP02324200 PH01000367:549680 C C_A
PH01SNP02324210 PH01000367:549890 G G_A
PH01SNP02324220 PH01000367:549912 C C_T
PH01SNP02324230 PH01000367:549932 C C_T
PH01SNP02324240 PH01000367:550070 A A_T
PH01SNP02324250 PH01000367:550094 G G_A
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_136214 4
Please click OG5_136214 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os11g41540.1 disease resistance RPP8-like protein 3, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
  1. Domain
  2. Domain
1 100 200 300 400 500 600 700 800 882
Detailed signature matches
    1. PR00364 (DISEASERSIST)
    1. SSF52540 (P-loop co...)
    1. PF00931 (NB-ARC)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR32200 (FAMILY N...)
  2. SSF52058 (L domain-...)
GO term prediction

Biological Process

GO:0006952 defense response

Molecular Function

GO:0043531 ADP binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 221970 170 289 8.52E-05 pfam13191 AAA_16 cl17189 -
superfamily 247743 170 289 8.52E-05 cl17189 AAA superfamily - -
multi-dom 216202 173 460 3.61E-75 pfam00931 NB-ARC - -
multi-dom 206026 600 655 0.00072819 pfam13855 LRR_8 - -
multi-dom 215633 163 436 8.43E-11 PLN03210 PLN03210 - C
multi-dom 222104 193 284 0.000400128 pfam13401 AAA_22 - C
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000367G0730 gene.
GAGGAGGACGCACGTGGGAGCCCTAGGGCATGTAGGACGTTGTCCATCCCGAGGTGGATGGCCCTGATCTCCGACGAGGGTGCTCGGCTGGGGCTCCTCCAAAGAGCAGATGGGCCGTCCACGAGACCATTGCCCTCTAGAGCCGGAGGAGGCTTCGTGGACTTAGAGTATTTTTTTGGTAGGAGCCATAGCCTTTCATCAATTAGCTAAGGTCCCCACGGACGGCGCCAATATTGTAGGTGTAAAAACCGAACATGAGTGAGGGGGTGGACGTCGGCCGTCTGATAGACCATCGTCCACGAGAGTAAAAAATGACACGAGGATTTATACAAGTTCAGGATCCGAGAGACCGCCTTACTCCTGTCAGTGAGCTAACGTGGGGTTACTTCCGGGGAGAGAGCCCCCGAGGGCTCGCTAGTTTGGATATGCTTCTTTATTGCTCAAGAGAGCTCTCTCTGAAATAAGGGATATATAGGACCAAAATACCCCTTTGGGGATGACTATTCTATGAGTACAAGTGAGCGGTACAATCGACCTTTGCAAGGTAATTACATTTCTGGATCCGTTAAGCATGTGTTAACTTAGTATGGTGGGTCCCACTAGTGAAAAGATGAATTATTCTTCCAACAATTATATTAAAGCAAATTGAACATAATTAACGATCATTTAAGCACACCGGACATATTCGAGAGAACAACAAACCAAAGTTTAGAGAGAGAGAGGGGTGCACGAAGGGGGGTAATTGTGAAGTCCTGGCACATCCAACATAGATATTCGTCTTGTGCGTGCATGACGAATTGAAACCACAAGAAGATTGCCCTATGGACGTGTCACCTGTAAAAAGCATACAAGAAAATGACATCGAGTTATGCATTTGCTCATCTTACAGAGAACAATAGTCCAGTTCATTCAAGATAACACAATTTCAGTCAAAAAAAGGAATTAAGCTCAAACAAGTCGATTCTACAACAGGGAGAAAGTTACACATAAGCTAAGCGGTA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCTGAGGCTGCTGTCTCTGCCGTGGTTTCAAGTGTCAGCAAGCTTGCAGCCCAGGAGACCTCGTTGCTATGTGGAGTCATGGATGAAGTGGGCTTCTTGAAAGATGAACTGGAGCGGCTGCAGGGATACGTTACTGATGCTGCGGCCAAGCAGAGGTTGGGAAACTCCCGTGTAGCCGTCTGGGTGTCACAGATCAGAGATGCTGCATACAAGGCCGAGAATGTTATTGAAGCCGCAGAGTACATGGAGAAGCGAAATAGGCTCAAGAAGGGTTTCATGGGTGCCATTTCGAGGTATGCTCGTATACCAAGTGATTTGATGGCTCTACACAAAATTGGTGCTGAAATTAAGAGGGTAAGAAGAAAGATAAGAGAGATATTTGACAGTGCAAACGGTCTAAATCTCATTGATTTGCGTCATACTGCAGTAGGGATGGGTCATGTTGAGGATGAGCCTCGGCAAGATTACGATGTTATGTATCAAAATTTTGAAGATGATGTTGTCATTGTTGGCTTTGAGGATGAGTGCGAAGAAATACAGGATAAGTTAGTTCACAAAGAGAACATGCTTAGTGTTGTCTCCATAGTTGGCATGGGTGGGGCAGGAAAAACTACGCTCGCCAGAAAAGTCTATACTTCATCTAGAATCCAAGATCACTTTGGCATAGTTGCTTGGGTTACTGTATCTCAAAAGTTCAAAGCCATTGATTTACTGAAGGATATTATGAAACAAATAATGGGGGCCAGAGATGAGTCTAGAGAAACCAATCAGATGCAGGAGTATGAGGTGGGAAAGAAGATCCATGATTTTCTATTGCAAAAAAGATATTTAGTCGTGCTTGATGATGTGTGGGAAATAGATACATGGAACCAAATAAATAGAATGATTAAAGTATTTCCTCATGTAAATAATGGCAGTAGAGTAATGTTAACCACCCGAAAGACTAATGTTGCACATCATATTGAAATGCCAACCTATGTTCATGATCTTAAGCTCTTGGATGATGAGAAAAGTTGGGAACTTTTTAGTAGCAAAGCTTTACCACCATATAAAAGGTCCGTGATATGTTATCTGGATGAGTTTGAAGAACTAGGGAGAAAGCTTGCAAGGAAATGTAATGGCTTACCACTTGCACTTGCAGTCCTGGGGGGTTATCTATCAAAGAATCTAAATTTAGAAGCATGGTCAGATATGCTTAAGGGCTGGGCATCAACAGAAAGTGGACAGATGATGCGAGTCATACTAGGTCGCAGTTACAACGACCTGCCAGATCATTATATGAAATCTTGTTTCCTCTATCTTGCTGCTTTCCCTGAGGATTATGTTATAACTGTGTCGGGTCTTATCGAATCATGGGTTGCTGAATGCTTCATTCCACATACAACAAAATACAAGCCAGAAGAAACAGCGCGCAAGTACATAAGTGAGCTAGCTCAAAGATGCTTGGTCCAAGTTGTTGACAGAAGCAGGGCACATGGATGGATTGAAGAAATAAGGATTCATGATATTTTACGTGACTGGTGTATAGAAGAAGCAAGACAAGATGGTTTTCTTGATGTCATTGACAAAGCTGCAGGTCAAGCTAGTGCATCATCATCCAATACAATGATATCCTATCGTACTTCATTTCAAACCTTCTGCGATGATAAGATTTTCCAGGCAACACCTAATCTCCGAACTCTAGTTGGCTTTGGACTTTCATCAATTTCCCCACCTAAGCTAAGATTTTTGAGAGTTCTTCACGTAGAAAAATCAAGCCTAGATAATTTCTCTAGAGTAATTGGTGGGTGCATTCACCTAAGATGTCTCAGGTTGAGAAGTTGTCAAAAGGTCACTCTCCCTTCTTCAACTGGACAACTTCTTTACTTGCAAACTATAGATATGAGGGACACACACTTGAAATCAATCGTACCAAACTCTCTATGGGATATCCCTACTCTAAGGCATGTTTACCTTAGTAGAGGATTTTCTCCACCAAAGAATGGGCGACAGAAAGAGCTCCAGATCTTATATTTATCTCTTCCGCGTTGTGATACTAAATATTGCTGTCGTGATATGGTGACGGTTTTGGGCCAAATGACCCAACTAACAACCTTCTACTTGGACTTGGAAGCCATCCCTACCGAGATGATTAAAATACTTGCAAAAAACATGCCTCACCTGGTTGATGTCTACCTTCATGCATTCGATGTGATCGATAGGCTGCCTGAGAGCCAACTCTTCCCACAGAATCTACGGAAGCTCTGTCTACGTGCTCGTGTCATTAAACAAGACCCGATGCCGGTCCTGGAGAAGCTTCCCTATCTCGTGGTGCTTGAGTTGGAGGGGTATGAAGGCCGGACCATGTCCTGCTCTGCCCAAGGGTTCCCTCGGCTGCAAGTGTTGCTACTTGGTAGGTTTTCCACTGAGGAGTGGAGGATAGAGGTCAGGGAAATGCCAAGGCTCTCTCACCTGACACTTTGGGTGTTCAATAAGATGAGCAAGCTCCCCGAGGGGTTGCTGCACCTTCCGTCCCTCAAGGAGCTGCGTTTGATCGTGTTCCAGATTTCTGAAGACGATAGCACACACAAAGAGCTACAGCGGAAAGGATGCAAGCACAAGGAAACAAGTGCTCGTGTTCAATATGTTGTTTTTGGTCCACCTTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000367G0730 gene.
GCTTCTTTGAAAGTGCTATAATTTTTTAATATAAACCAATGGTTACGTTCACGAATTCTGATCTATATTTTTTCTCTCGAGCGAAGAGATTTTTTCAATAAAAAAAATTAACGCACCAGAATTGGATGGCAACGGACCGGGTCTATTCCCCGCGGGGGACACTTCCATCCTCATCGACAAAACGAGCTGTCTAAACAACCTAGCCTCTGTCCGTTATGATGGTGAAATCAACTCTACGGCGTGGACAGCCAAGCAAAGCTTCACCATTCGTGCATGGGCCAAACCAAACTATACAAAGATTGTGTCATTGGTGGCAGCTTGCAACAATGTATCAATATCAATATTAGTAAGTGCTGGCTTCACCGACATGCAGTTGATTCGTACCAATGCCTTGATTAAACTAATTGATCCAAGAAATTTAAGCTATTTGCAATGAACATGTCACTCATTGCGATGCATAGGCGTTTCACTCAAAAATTTAAGCTGTTGGGACAAACTCCAGTACACCTCGTCTCTGGATAGATACGATCAGATCGAACTTTGGAAGTTGTGTACTTGGTATCAAACATGCCTCATGATTTCTTGATCCTGACATCATACTACTACAGAAAATGTTATCACAGACGGTTTTCTGAACCGTCTGACTTTATGGGTCAGTGTGATACTATGAGGTCATCACAGACGGTTTTTTAACCATCTATGAAAAAAGCTATCACAAAAAACCGTCTGTGATAGTTTTTTCTATTGCAAAAAAAATTCGAATTTTGAGCTAAACCAATCAATTGCTGGACAGTTGGACCTGAGTATCTGCATATGGTTGATTACATAATCTAGAATGAAACAAAACTCAAACTGGACGGTGAACGAGCGGCAAAAGCAGGTGCTGAAACTTCGGAGGCAGTTTTGAGGTCCTAAACGACCTTTTTTTTTTGGGGGGGGGGTGGTTCACTTTTTCGGGGCCTCGCGAAGAGAATTTGAAGGTTTTTGGATTGAACTTTTCG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000367 Download
Protein sequence
Protein sequence
MAEAAVSAVVSSVSKLAAQETSLLCGVMDEVGFLKDELERLQGYVTDAAAKQRLGNSRVAVWVSQIRDAAYKAENVIEAAEYMEKRNRLKKGFMGAISRYARIPSDLMALHKIGAEIKRVRRKIREIFDSANGLNLIDLRHTAVGMGHVEDEPRQDYDVMYQNFEDDVVIVGFEDECEEIQDKLVHKENMLSVVSIVGMGGAGKTTLARKVYTSSRIQDHFGIVAWVTVSQKFKAIDLLKDIMKQIMGARDESRETNQMQEYEVGKKIHDFLLQKRYLVVLDDVWEIDTWNQINRMIKVFPHVNNGSRVMLTTRKTNVAHHIEMPTYVHDLKLLDDEKSWELFSSKALPPYKRSVICYLDEFEELGRKLARKCNGLPLALAVLGGYLSKNLNLEAWSDMLKGWASTESGQMMRVILGRSYNDLPDHYMKSCFLYLAAFPEDYVITVSGLIESWVAECFIPHTTKYKPEETARKYISELAQRCLVQVVDRSRAHGWIEEIRIHDILRDWCIEEARQDGFLDVIDKAAGQASASSSNTMISYRTSFQTFCDDKIFQATPNLRTLVGFGLSSISPPKLRFLRVLHVEKSSLDNFSRVIGGCIHLRCLRLRSCQKVTLPSSTGQLLYLQTIDMRDTHLKSIVPNSLWDIPTLRHVYLSRGFSPPKNGRQKELQILYLSLPRCDTKYCCRDMVTVLGQMTQLTTFYLDLEAIPTEMIKILAKNMPHLVDVYLHAFDVIDRLPESQLFPQNLRKLCLRARVIKQDPMPVLEKLPYLVVLELEGYEGRTMSCSAQGFPRLQVLLLGRFSTEEWRIEVREMPRLSHLTLWVFNKMSKLPEGLLHLPSLKELRLIVFQISEDDSTHKELQRKGCKHKETSARVQYVVFGPP
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above