gene PH01000365G0370
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000365:284825 - 288624(+ stand)   Name
Alternate name Locus tag PH01000365G0370
Length of gene 3800  bp Length of CDS 627  bp
Product information
Feature type
CDS
Product name
ribosomal protein S6
Alternate name
Molecular weight
(predicted)
22206.45382  kDa
Isoeletric point
(predicted)
8.52700424194336
Length
208  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP02311140 PH01000365:286080 C C_T
PH01SNP02311150 PH01000365:287387 C C_T
PH01SNP02311160 PH01000365:287457 T T_C
PH01SNP02311170 PH01000365:287719 C C_T
PH01SNP02311180 PH01000365:287748 A A_T
PH01SNP02311190 PH01000365:287760 G G_A
PH01SNP02311200 PH01000365:287821 A A_G
PH01SNP02311210 PH01000365:288059 G G_A
PH01SNP02311220 PH01000365:288398 A A_G
PH01SNP02311230 PH01000365:288430 T T_C
PH01SNP02311240 PH01000365:288440 T T_A
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_158915 3
Please click OG5_158915 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT1G64510.1
Translation elongation factor EF1B/ribosomal protein S6 family protein
Translation elongation factor EF1B/ribosomal protein S6 family protein; FUNCTIONS IN: structural constituent of ribosome, rRNA binding; INVOLVED IN: translation, ribosome biogenesis; LOCATED IN: thylakoid, chloroplast thylakoid membrane, ribosome, chloro
2E-57
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os03g62630.1 ribosomal protein S6, putative, expressed 8E-79
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
1 20 40 60 80 100 120 140 160 180 208
Detailed signature matches
    1. SSF54995 (Ribosomal...)
    2. PF01250 (Ribosomal_S6)
    1. MF_00360 (Ribosomal_S6)
GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding

Cellular Component

GO:0005840 ribosome

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 216388 101 202 3.17E-23 pfam01250 Ribosomal_S6 cl00414 -
superfamily 241850 101 202 3.17E-23 cl00414 Ribosomal_S6 superfamily - -
non-specific 179034 101 206 3.00E-16 PRK00453 rpsF cl00414 -
non-specific 223437 101 206 8.95E-16 COG0360 RpsF cl00414 -
non-specific 177046 100 202 3.64E-15 CHL00123 rps6 cl00414 -
non-specific 129270 101 202 6.16E-09 TIGR00166 S6 cl00414 -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000365G0370 gene.
CATGCATTGGATGTTGATATACATGATTTTTTTCGTCTTACGTTGCAGGAAAATATTATCTTGTTGATACCGGTTATCCAAACAGGCCTAGGTACTTAGCGCCATACAAGGGGCAAAAGTACCATGTTCCAGAATTTCGAAGAGGTGTTGCTCCTAGTGGTGAGAAAGAGATATTCAACCATTTGCACTAGAGTGTTCGCAACGTAATTGAGAGGTCTTTTGGTGTATGGAAGATGAAATGGAGAATTCTTCTTAAGATGCCGAGCTTTCACATGTCCAAGCAAAAGATGATTGTTGCAGCAACCATGGGAATCCACAACTTCATACGTGAACATGCTTCGCCGAACATGCATTTTCGTAGGTTTGATCGGGATCCTAATTATGTGCCCACAATACCATCAAGATATGCCAAATATGCCATTTCTTATGATGCATCAACTTCGCAAACGAGTGTTACATCCATGGATAGTTTCTGTGATGACCTTGCAAGTGCAATTGCTCAATCAGGATGATGGACACACTACTTGTCATATTTTGTGGTCTTTTGTTATCACTTATTTAGCATTCAAATACTTGTACGTAATAGCATTTAATTAACATTTGAACACTTATATGATATAAATGCAATATTTGTCTAGCTTCATCTATCGTAGCGTGACCAATACAAAATTTGCTTATACGATTGTGGGTCAATTCGTTATTTGCCAACAGTTGTACTTCATCATGAAGTGTAAATGCAATGTAACATGGTATTGTGTACAAATACAACGTATATACATTCGTATGGTCTAAACAAATTTAGAGGAAAATTCTATAATTTGTGTGCAAATATATAGGAGAAAGACACAAATACAATTGAAGTATTATAACCAAGGGTAGTATGGTCTATTTGCATCTAATTCTCTCTTGTATGGTTTTTGGAGTCAACCTACCAGCCAAACGCTTTCAACAGACAATTCTAAATTTTCAGAAAAGTGGATTATCAAATAATTAGAAGTAGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGCGCTCTCCATCTCCTCCTCCACCGCGACCCTGCCCACGCTCCCGCCCTTCCCTTCCCGCCTCCCGCGGTGCCTCCCCGCCGCGCCTCGCCGCGCCCGCGCGTTCTCGGCCGGCTATGCCGCGAGCTTCTACGGCGGCGCGGCGTCCGCGGCCGGTGTCGGCGACGAGGAGGGCTCCGCCTCGGGGTTCGGCAGCGGGTTCGGCCTCGGCCTCGGTGGCGGTGGGCTCGGGATGTCGGCCGCAGATGCGGCGCTGGCCCTGGAGGAGCGGGAGATGCCGCCCTGCCCGCCGGGGCTGCGCCAGTACGAGACCATGGTCGTGCTCCGCCCCGACATGTCCGAGGAGGAGCGCCTCGCCCTCATACAGCGCTACGAGGAGCTGCTTGTTGCCGGTGGCGCCATGTATGTAGAAGTCTTCAACCGAGGAGTCATCCCACTAGCCTACAGCATCAGGAAGAGGAACAGCAGGACTGGGCTACCATCTACCTACTATGACGGCATATACCTCCTTGTAACATACTTCACAAAGCCTGAATCCCTGTATGCCCTGCAGCTGAGGCTCAATGCCGACGACGATGTTATCCGCTCAACCAGCTTCAAGGTCGGCAAGCGGAAAGCTTTCTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000365G0370 gene.
AAAAACATCTGGTGCTGACGAACAAAAAACTGTTTTTCGTACATCATAGGTGTAACATAAAACAGGATATGCTGGCCCACCACATTAGGTCAGTCAAACAAAATGATGAAGAAAGCACAAGGTTTGACTGCATCAATCCAGCAACGAAGACAATATAATGCTTCCAGAATTCTCCGGTACAAAGCACAACTTAACATCATCTCAAATCGAAAATAACCTTACTATCACGTAGGAAGACCAGAGTACTCCAAAATCAGCCAGCCATGGATCAACAGATTCACTATCTATCGTGGCGCCTGAAAATCGCAACAACTGTCAGGGTTGACCAATGACAATAACAAGGATTTCAAATCAAAAGCAGAAAGTTTCATTATGTTCTTTGTCGTTCCATGGTCAAATGTTTTAGTTTGGCATAAATAGCTCTACAAGCATGAAGGCAGACTTACTTTATTTGGATAAAAAACTGTACGCAAAAATAAATCGTTCAGCAATACCTGCGTTCCCTGGATCGAGAACGATCCCTTCTCCTTGAATCATGGCCACGGGAGCGGTCATAGTCTCTATCCCGATCGCGGTCATGGCGACGATCCCTATCATGGCGTCTATCGCGATCCCTATCATGGTCTCTTCTGCTTTCACGAGGTTCAACTCTTTCCTTTCTTTCTACATCTCTATCCCTGGATGCCCGACCATTGCGGTCCTTGCTGTGTTCTCTTGATCTAAAAAAACCCAATATGTACTTTCATTTCATGTCATTTACTATATTAAAATGAAACAAGGATGGGGAAGACCGTACCGCCTGTCATCTTCGGACCTGTCCTTCCTTCTTTTATTCCTCTCCTCCTGGAAGATGGTACGACATATTTTATAATGATAAAAAATCATGATATCGACATACTTACCAAATGGAGAATAACTAATAAAGGACAGCGTTTCAAAAAGTAAAAACGAAGTGCAAGAGATACATTACAGTCAAGATTGCTTCAAGTCAAGATTGCTTC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000365 Download
Protein sequence
Protein sequence
MALSISSSTATLPTLPPFPSRLPRCLPAAPRRARAFSAGYAASFYGGAASAAGVGDEEGSASGFGSGFGLGLGGGGLGMSAADAALALEEREMPPCPPGLRQYETMVVLRPDMSEEERLALIQRYEELLVAGGAMYVEVFNRGVIPLAYSIRKRNSRTGLPSTYYDGIYLLVTYFTKPESLYALQLRLNADDDVIRSTSFKVGKRKAF
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above