gene PH01000333G0270
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000333:178128 - 180425(+ stand)   Name
Alternate name Locus tag PH01000333G0270
Length of gene 2298  bp Length of CDS 1419  bp
Product information
Feature type
CDS
Product name
BURP domain containing protein
Alternate name
Molecular weight
(predicted)
47356.63752  kDa
Isoeletric point
(predicted)
9.29054641723632
Length
472  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP02139170 PH01000333:178334 G G_A
PH01SNP02139180 PH01000333:178461 C C_T
PH01SNP02139190 PH01000333:178722 G G_A
PH01SNP02139200 PH01000333:178818 A A_C
PH01SNP02139210 PH01000333:178858 A A_G
PH01SNP02139220 PH01000333:178871 T T_C
PH01SNP02139230 PH01000333:179174 T T_C
PH01SNP02139240 PH01000333:179261 G G_A
PH01SNP02139250 PH01000333:179343 A A_T
PH01SNP02139260 PH01000333:179457 C C_G
PH01SNP02139270 PH01000333:179472 G G_A
PH01SNP02139280 PH01000333:179576 C C_T
PH01SNP02139290 PH01000333:179593 C C_T
PH01SNP02139300 PH01000333:179619 G G_T
PH01SNP02139310 PH01000333:179648 C C_A
PH01SNP02139320 PH01000333:179678 C C_T
PH01SNP02139330 PH01000333:179708 G G_A
PH01SNP02139340 PH01000333:179882 G G_T
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_190623 1
Please click OG5_190623 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g53240.1 BURP domain containing protein, expressed 5E-147
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 300 350 400 472
Detailed signature matches
    1. SM01045 (BURP)
    2. PF03181 (BURP)
    3. PS51277 (BURP)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31236 (FAMILY N...)
  2. PTHR31236:SF0 (SUBF...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 202568 257 470 1.05E-116 pfam03181 BURP cl03923 -
superfamily 243575 257 470 1.05E-116 cl03923 BURP superfamily - -
non-specific 214992 257 468 3.37E-72 smart01045 BURP cl03923 -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000333G0270 gene.
GCACTGATGAACATGAACTTGACCTAACCCAAAATCAATTCTCCAATTGAAACAACATTTAGCTCAATTCATTCCAAAAGCGGTACTACCGCCACACATTCACCGGTATTACCGCCATACGGTCATACCGCTCAAAGCACTGCGGTCATACCGCCACTCAAGGAATCCCAAAATCTCCAAAAACAGCTCCTCTGAAAAATCCATGCCGCTCTCAAGCGGTCATTCCGCCATGCGGTACTACTGGCAACCAAAGCACGGTACTACCGCTCCTTGAGAAAACCCATACCTCAGAGACACCTTCTCTGGAAAAATGCAACCGTCATTTACCTTGCGGTACAACCGGCTCACGGTACTACCGCCACTTCCCCAGCGGTACTACCGCTCCACAAAAATCCGCAAAGTCCTCAGAACAACGTCCTTTGCCACGTGGACGCTCCAGATCAACTGGCCCGTTCGGACCGCGCCTTTAAACCATCAGATCAGGGGCACTATTCAAAGTCCGAACATCTCAATCAGATTGGGCCGTCCGATTTCAATCAAACGCCTCTCAAGAAATCCAACGCGGCCAAGTGACTCGCGGTAGTTCCGCTCACTCTCTTGCGGTCATACCGCTATCCGGTAGTACCGTAGCTTCAAAGTCGGTACTACCGATTTTCCTGACACTTGCTGAAAACTTCAGATTTCAACAAACTCTGAAAGCAATTGCCAATTGTCGCATCACCTAAGATCATGAGCATGTCCATATGACATCCACAATACCCTCATGATATCCACAGACAGTCTCTTCAGGAAGAGACGACATGTGCTCTCTCTTCTCCACATAAGATTTTGTTAACATGACGTAGCTAAAAGACGACAATAAATACACTATTAAAGATGTTCCGTACATTCGTACTCGGCGACTGATCGGTGATACTATTGCTTGCCTCAGATAGCGTAGTTAATTTATCGACTTGTGCCAATTAATTCCCCCAACTCCCAAGCTACTTTCTGGTTTGGTT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGATAGGCTCCTCGCGGGCCTCCTTGGCTTCCTATTGATTGCGTCAGTAGGAAGCCATGCAGCTCGGGCTCCGGAGCAATACTGGAAGTCTGCTCTTCCCAACACTCCCATGCCAAGCTCACTCTCTCAACTCCTCAACACTCCAGCCGGAGGCACGTCCGTGAACGTCGACCGGGGCGGTGTCCATGTCGACGCGGGGCATGGCAAGCCCGGGGGCACGACGGTTGACGTTGGCAAGGGTGGCGTCGGCGTGAACGTCAACCCTGGCAGCGGCAAGCCCGGCGGGACTACGGTCGGCGTTGGCAAGGGTGGCGTGGGTGTCAACGTCAAGCCTGGCTACGGCAAGCCCGGGGGCACCACGGTTGGCGTAGGGAAGGGCGGCGTTGGTGTCAACGTTAACCCTGGCAGCGGCAAGCCCGGTGGCACCACGGTCGGCGTTGGGAAGGGCGGCGTTGGCGTGAACGTCAACCCTGGCAGCGGCAAGCCCGGCGGCACCACGGTCGGCGTTGGCAAAGGAGGCGTGGGCGTTAATGTGAATCCTGGCCACGGCAAGCCCGGTGGCACCACGGTTGGCGTTGGCACGGGTGGCGTCGGCGTCAACGTCAAGCCTGGCTACGGCAAGCCCGGCGGTACCACGGTCGGCGTTGGCAAGGGCGGGGTTGGCGTCAACGTGAGACCCCGCGGGAAGCCTGTCGACGTCAATGTCTCACCTTTTAATTACGACTACGCCGCAACGGAGACGCAGTTGCACGACGACCCCAGCGTGGCGCTCTTCTTCCAGGAGAAGGACCTCCACCCCGGGAAGAAGCTGGCCGCCCATTTCACGGCCACCACGGCCGGAGCAAAGTTCCTCCCGCGAAGCGAGGCCGACGCCATCCCGTTCTCCTCCGAGAAGGTCCCCGAGATCCTTAGCCGCTTCTCCGTGAAGCCGGACTCCGTCGAGTCGGCGGAGATGACGCAGACGCTGCACGACTGCGAGGAGCCGGCGGCGAAGGGCGAGAAGAAGGCGTGCGCCACGTCGCTGGAGTCCATGGTCGACTTCGCCACGTCCAGCCTCGGGACCAGCCACGTCAGGGCCGTGTCGACAGTCGTCGGGAAGGAGGGGTCGCCGAAGCAGGAGTACACCATGACCGGCGTGAAGCGCACGGCCGGCGCCGACAAGCTCGTGACCTGCCACGCGGAGCCGTACGCGTACGCCGTGTTCGCGTGTCACCTGACGCAGGCGACGAGGGCGTACACGGTGTCGATGGTCGGCAAGGACGGCACGGCCGTGGAGGCCGTCGCGGTGTGCCACGCTGACACGGCCGGGTGGAACCCGAAGCACCTCGCGTTCCAGGTGCTCAAGGTGAAGCCCGGCACGGTGCCGGTCTGCCACTTCTTGCCGCAGGACCATGTCGTCTGGACCCGCAGCGGCTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000333G0270 gene.
ATAAAAAGACTGGTATTTATTTACATCTATTTATCATTACTGTTACCTGCCTAAAAAAACTTCTCTTGATCTTCAATGCTTCGATTACAAGAGTAGCTCAACTTAACCAGACGGAGGGTGTGGCTTCAAATATTCCAAGGCGCCAACTCGTACTGAAATAGATCTCACCACATCTCAAAAAGTAAAAAAGAAATAGATCTCACTCAGGAACCCAACAATCAAGATGCCACCCATGTATTCGAGGTTGTGTGAGCCCATTCCAGGGCCACAAGGCCCACAACAACAGGGCAAGCAACAACGAGAAAAAAGGTTAAAGAGTGTAGAAAAATAATTACTACCCTTAAATCCTGAGAGAAAAGACTACCTCCCGCACCCTCTACGTCACTCCAAAAAGGCGGTCCGTCGGATCGCTTGCCATGCGGCCCAGATCACGTGGAGGGAGCGATTCTCCGGACGCGCACCGATCTCCATCGAACGGCTGCCATCACGTGGAGCACGCAGACCCTAATCTCATCCATCTCTCTCCTCCCATCTGCTTGCTCGCAACACTGGCTCGATCCCGTGCCACCGCACCTCTCCTCGCTGCTTTCCCCTCCGTCCGCCCCTTCAGTCTACCTCCACAGCCACTGCCGCCCCCTCCATCTTCTCCCCTCGCCGCCCCCTCGGTCTCCCTCCCAAGCCGCCACCTCGGCGCCACCCTTCCCTTCTGTACCCTTGCCTTGCGGCTGCCTACGCCGCCGCTGCCGGTACCACCGGCCGCCTTGTGTTGAGTCACGCCGCTTGGCCTCCACCCCCTTTCCGCCTCCTCTCTCTCCCGTCCCGCCTCCGGTCCCTTCGGTCCGCATCGCCTCCGGCTCCTGTCCCCTTCCTCTCCCTCCTCCGCTGCCCCTCTCCGTGAGCATGGTCGGTCCCTCCCTATTCCTCCCCTGCCACCCTCTCGGTATTCCTCCCCAGCCGCCACCTCAGTGCCTCCTGGACTGGCGATGCACGAGTTGCAGAGC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000333 Download
Protein sequence
Protein sequence
MDRLLAGLLGFLLIASVGSHAARAPEQYWKSALPNTPMPSSLSQLLNTPAGGTSVNVDRGGVHVDAGHGKPGGTTVDVGKGGVGVNVNPGSGKPGGTTVGVGKGGVGVNVKPGYGKPGGTTVGVGKGGVGVNVNPGSGKPGGTTVGVGKGGVGVNVNPGSGKPGGTTVGVGKGGVGVNVNPGHGKPGGTTVGVGTGGVGVNVKPGYGKPGGTTVGVGKGGVGVNVRPRGKPVDVNVSPFNYDYAATETQLHDDPSVALFFQEKDLHPGKKLAAHFTATTAGAKFLPRSEADAIPFSSEKVPEILSRFSVKPDSVESAEMTQTLHDCEEPAAKGEKKACATSLESMVDFATSSLGTSHVRAVSTVVGKEGSPKQEYTMTGVKRTAGADKLVTCHAEPYAYAVFACHLTQATRAYTVSMVGKDGTAVEAVAVCHADTAGWNPKHLAFQVLKVKPGTVPVCHFLPQDHVVWTRSG
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above