gene PH01000323G0330
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000323:222931 - 223997(+ stand)   Name
Alternate name Locus tag PH01000323G0330
Length of gene 1067  bp Length of CDS 738  bp
Product information
Feature type
CDS
Product name
dof zinc finger domain containing protein
Alternate name
Molecular weight
(predicted)
26214.2444199999  kDa
Isoeletric point
(predicted)
6.15888595581054
Length
246  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP02087030 PH01000323:223023 A A_G
PH01SNP02087040 PH01000323:223073 G G_A
PH01SNP02087050 PH01000323:223105 T T_C
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_126576 6
Please click OG5_126576 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os08g38220.1 dof zinc finger domain containing protein, putative, expressed 6E-82
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
    1. PF02701 (zf-Dof)
    2. PS01361 (ZF_DOF_1)
    3. PS50884 (ZF_DOF_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31992 (FAMILY N...)
  2. PTHR31992:SF0 (SUBF...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0003677 DNA binding
GO:0008270 zinc ion binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 111583 51 106 2.60E-35 pfam02701 zf-Dof cl03664 -
superfamily 111583 51 106 2.60E-35 cl03664 zf-Dof superfamily - -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000323G0330 gene.
CATGCCCGATCCAGTCCAGGCAGCCGGGCCCATGCGGCGCGCTCTGTTTGGCTGGGAACTTAACTGGGCCCTGGATCGGATTCGTCGCCAGTGGGTGAGTCAGGAGCCAGGAGGAACAAGAACATTGGCGCCAGTGGAACAAATGCCACGCACCAGAGTCTCCAATTAAACCAGTCGAGATCGACTCAGCATCCAATGAGATGATCAGTCGGCGCGCCGCTGGAGCATTCCAGGAGCAGGAGCAGTGCCGGTTCGGGTTGGCCGCTCGGACTCGGAGCAGGCGGGCAGGCGTCAACCAGAGCGGGCCCCGCCGGCGTACGAGGCGGCCCCACGTCGCCTAGCCTAGCCTAGCCTAGCGCGAAGCATTGGCTGCCCAACTGATGCCCTCCGCCCACGTGGCGCGGCCCCCGACCACCCGCGCCGGTGGCCGACACGGCGCATAGTTCCGTGCCCGAGACGATAAGCCCCGTACCCACCTCGCCCGCTCGCCGGTGACCCGCGGGAACGTCACCGAATGCCACTGACTCGCGGACCCGTTGCTATCGTGGCCGCCGTTGTCATCGACCGTGAGGCGACGTTGGCGCACGGTTGTTTTGGCGGGGAGAACAGTAAGCTGGGGGAGCAAAATAACGTTGGCGCACTGTCGTGCCGCGCTAGGCGCCACGGCCTCGTACGGGCCGGCCGCGACAAGCGGCGGCCACCACCACCGCCCTCCCGTCACGGTAGGAAATCTCTGCCCTTGTTATTTTGCTCCGGCACACGTACACCTCCTGACATAACACGCACACCCACTGACAGGTTGGCCCATTCTCTGCCCCCACAAACGAACGGCTCGCACCCGGAACCCACCCACGTCACATGGTGAGGTGCCACCGACATGTGGGCCCGGACGGTGCCCCCACCGGGGAACTGGTAGTACTTAGGTCGCGTAGCCGAGCCGTAAGTAACCATCGTCATAAACCGCGACCATAAGAGAACCCGGCGCCAAACATCCTCGCCTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGCAGGAGCAGCCCCTCCACGCGGCCGAGCCTGGCCGCCGGCCGGCGCAGCAGTTCGCCGGCGTCGACCTCCGCCGCCCCAAGGGCTACGCTGCTCCCTCTCCGCCTCCTGTCGCCACGGCGGCACCTGCCCCGGCGGCGAAGGCGGTGGGGGAGGGAGAGCCTTGCCCGCGGTGCGAGTCGCGGGACACCAAGTTCTGCTACTACAACAACTACAACACCTCCCAACCGCGCCACTTCTGCAAGTGCTGCCGCCGCTACTGGACCAAGGGCGGCACCCTCCGCAACGTCCCCGTCGGCGGAGGCACCCGCAAGAAGTCCTCCTCCTCCTCCTGTTCCTCCCCATCGTCATCCTCTGGCACCGCGGCCAAGCCCCAGAAGCCCTCCAAGAAGCGCCGCGCCGCGCCCCCCGATCCTACCACCTCCGTCGACGTCGTGACTGCCCCCGACTCCACCAAGACGACCGAAACAACAACGACCCCACCGACCGACGCCGCGAGCGAGATCACCACGGAGCTCGTGGTCCCCGCGATGGAGGAGGACTCCTTCACGGACCTGCTGCAGCCGGACTACGACGTCGCCGTCGCGCTCGGGCTCGACTTCTCGGACTACCCGGCCGGCAGGAAGGCGCTGTTGGACCCGGACTCGTTCGAGTGGCCGCCTGCGTTTGACCTGGGCGCGTACTGGAGCGGCGCCGGTTTCGCCGACCCGGACCCGGGCGTGTTCCTCAACCTCCCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000323G0330 gene.
ACATGGTCCTCCGTTTCTTTAATTTCTGCCTTTTGAAAGGCTTCTACATGGAATGTATTGAAAGCTGCTGCATGGAGAACGTTTTCTTCCAGTTTCTTCTTGCTTTATACACTCTTGCCTCTTTTTTATGTCATGATGTACTAGCCGGTGACTGCGTGCAATGCTCATTTCTCATGGTAAGACCAAGTTGTTCATGTGCTGGTGGCAACTTCCCGTGCCATTCGAACGGCACATCTTTGGATGTCTCCGCAACTTCTCGGCCAATTCGTCGGTTTCAGCCGTCCAGGCCTCGATCAGATGACGAATGATTCGGTGGTTCCAGCCGTGCGAGCCTCGATCAGCGAGATGATTCCGAGCTCCCGGAGCGAGCCGTTTGAACGGACGCGGCAGAGCATCCGATTCCGGCCGGGTCGTTATCACGCGCGTATCTTTCGACATCGCACCTCCGATCGCGTAATGGCTCGCCACCGTAACCGCGGCGCGGTACCGAGAATAATTGAGTAGAGAGCAGCAGCGTCTCGTTGGCGCCGATGCGATGCGAACGACGGAACGAGACAACTCGGTAGTCGGTACTGGTACAGTTAGTATCCGTCGCTCGCACAGTTGGGGAATCGCAGGGGGCGATGGCGCGCGGGTCAAGTCAGTGCAAGTGCGAGGCACCCCCAGCCCCCCACCGCGGCGGCGTAGCGGCCGGGACGCGTTCGCGTAGAGCGGTCGGTCGGACGTCGCGGTCGGGGAGTTAATTGGTGGATGCCCGATCGATGGACGCCAACGCGCGCGGCCCCCGTGACCCCTCGACCAAGACGCTTCCGTGCGCGTCGGGGTCAGTCGGTCAAAACGCCCGCTTGCGCGCGGTGGCCCGCGCGGCTGCTGCCGAGGCGCTGACCGCGACGGGTTTTTGGCCGATCGGGCGGACTGGCGCGAGGCGTGAGGCGTGGCGTGTCATGTGTGCTGTCGGTAAACACTGCTTGTTTGAGAGTGAATCCTCGACTTCGGTGGTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000323 Download
Protein sequence
Protein sequence
MQEQPLHAAEPGRRPAQQFAGVDLRRPKGYAAPSPPPVATAAPAPAAKAVGEGEPCPRCESRDTKFCYYNNYNTSQPRHFCKCCRRYWTKGGTLRNVPVGGGTRKKSSSSSCSSPSSSSGTAAKPQKPSKKRRAAPPDPTTSVDVVTAPDSTKTTETTTTPPTDAASEITTELVVPAMEEDSFTDLLQPDYDVAVALGLDFSDYPAGRKALLDPDSFEWPPAFDLGAYWSGAGFADPDPGVFLNLP
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above