gene PH01000317G0460
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000317:292221 - 295414(+ stand)   Name
Alternate name Locus tag PH01000317G0460
Length of gene 3194  bp Length of CDS 1134  bp
Product information
Feature type
CDS
Product name
F-box/LRR-repeat protein 2
Alternate name
SKP2, FBXL1
Molecular weight
(predicted)
40262.10112  kDa
Isoeletric point
(predicted)
7.44601821899414
Length
377  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_153396 3
Please click OG5_153396 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT1G21410.1
F-box/RNI-like superfamily protein
AtSKP2;1 is a homolog of human SKP2, the human F-box protein that recruits E2F1. Contains an F-box motif at the N-terminal region and a C-terminal Leu-rich repeat domain. Forms part of an E3-ubiquitin-ligase SCF (Skp1, cullin, F-box) complex and recruit
SKP2A; CONTAINS InterPro DOMAIN/s: F-box domain, cyclin-like (InterPro:IPR001810), F-box domain, Skp2-like (InterPro:IPR022364), Leucine-rich repeat, cysteine-containing subtype (InterPro:IPR006553); BEST Arabidopsis thaliana protein match is: RNI-like su
1E-152
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g65920.2 F-box/LRR-repeat protein 2, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
Detailed signature matches
    1. SM00367 (LRR_CC)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF13516 (LRR_6)
  2. PTHR23125 (F-BOX/LE...)
  3. SSF52047 (RNI-like)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 187754 126 275 7.39E-18 cd09293 AMN1 cl15308 N
superfamily 199166 126 275 7.39E-18 cl15308 AMN1 superfamily - N
non-specific 187754 153 356 3.22E-17 cd09293 AMN1 cl15308 N
non-specific 197685 258 283 9.02E-05 smart00367 LRR_CC cl15308 -
non-specific 197685 232 257 0.000392838 smart00367 LRR_CC cl15308 -
non-specific 197685 206 231 0.000790862 smart00367 LRR_CC cl15308 -
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000317G0460 gene.
CATCCTGCGTCCACAGGCAGCCGCCAGTTCATAACTGCGGCTAAATTTTGGAATAGATTGCCTCTAGGTAGCGGTGATTCTTCGCATCGTGGACTGGGTGAGTGGAAAGCTCGCGTCTTTCTCTCTTATGGATTAAGGAATTTCTTGGTCTTTTTTGGGGGGGGGGGGGGGTTGTGGTCTGCTCTCGATGCTGAGATCGCCTTCAGAGACCGGATTCTCCGTGGTTTTCTGCTGTCCCCTTTGAATCTTTGAGGTTTTGTCTGCATTTCCGTAGGGTTTTTTTTTTGTGTGGTTGTTTGTGCGCGAAAGCTACTGCAATCCTCGGCAAGCTTTGCAGTTGTTTTCTTGGATATTCTTTTCATCCCGATATTTGTACTGGGTCCCTGTCTTGCCCGGATGCTGGCTGAGCTGCGTGGAATTTGACTTAGTTACCATTTAGCCCCTGAAGATCTGGGCTTTCTCTATGGTTTTTCCTGGATTAGCTTCTGGTGGTCTCGAATCATCCGAAGCTTAGTCTCTGATGCCTTAGCGTTAGAAGGAACCGGAAATTTCGATACTTTGCCAAAAGAAAGGCTCGGCAGCTTCACCTTCCCCCTCGCCTTATACTTGCCGTTTCCTCTCCATTTTGGCTTAATGCGTTTCAGACCTTTTGGTGAAGTTATGTGCGAGTTTCTGGATCGAAAGTTGGTAATTGCAGCAAATATTCGCTTTTAGGAGTCCCATGATGTATCTGTCTGTGATCGCCATCTTGATGCAGAGATCTTGATCGCAAGGTCGCTCCTAGTAGTTTTGCCCCGTCTCTTTTCATTAGCTGCCTTTCGGGTTCTTTTGAAGATTTGAGTTATTTTTTGAACGATTGTTGCTATAATTGTTGCATATTGAAGCAATAGCGTCTATATTCTTGATCTTATGATTGCTCCATGCAGCTGCATCTATGTTTCGGAGCTATTTTTGCGGTTAATTTGTTTTATTTTAGTAGAGGTCAGGCGTTTAAAGGAGTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGAGTGGGGAACTGAACAATTCATTCGACGCCCTCTTGGTTTCTGGTGGCCGTGAGAGTGGACAGGCACAAAATGGTGGCACAGGGACCACCTTGTCAGGTTGGAAGGACCTTCCCATGGAGCTGCTCCTGAGGATTATATCGATAGCTGGAGATAACAGGACGGTCATCGTGGGCCTCGTGGCCTCCGGTGTTTGCACCGGGTGGCGTGATGCATTAGGATGGGGAGTCACAAATCTTTCCCTCTCGTGGTGCAAGGACCACATGAATGACTTAGTAATATCACTGGCTCACAAATTTACAAAACTTCAAGTTCTGTCTCTACGGCAAATCAAACCTCAGCTTGAAGACAATGCAGTGGAGGCTGTGGCAAATTATTGTCATGACTTACGCGAGTTGGATCTTAGCAGAAGCTTTGGGCTTAGCGATCGGTCTTTGTATGCTCTGGCACATGGGTGCCTTCATCTTACCAGGCTTAACATTAGTGGATGTTCCAATTTTAGCGATGCTGCTTTGACCTACCTCACTAGTCAATGCAAGAACCTGAAATGCTTGAATCTGTGCGGATGTGTAAGGGCAGCTTCTGACAGAGCATTGCAGGCCATCGCCTGTAACTGTGGCCAGCTGCAATCTTTAAACCTAGGTTGGTGTGATAGTATCACTGACAAGGGAGTGACAAGCTTGGCATCAGGATGTCCTGAACTTAGGGCTGTGGACTTGTGTGGTTGTGTTCTTATAACAGATGAGAGTGTGGTTGCTCTTGCAAACGGGTGCCCTCACCTTCGGTCCCTGGGCCTGTACTACTGCCAGAACATCACCGACCGGGCCATGTACTCGCTCGCGAACAGCCGCGTGAAGAGCAAAGGCCGGAGCTGGGACGCGGCGAAGAGCAGCAGCAGCAGCAGCAGCCGCGACGACAAGGACGGGCTTGCGAACCTGAACATCAGCCAGTGCACCGCGCTGACGCCCCCGGCCGTCCAGGCGGTGTGCGACTCCTTCCCGGCGCTCCACACGTGCCCGGAGAGGCACTCCCTCATCATCAGCGGCTGCCTCAGCCTCACCTCCGTCCACTGCGCCTGCGCTCTTCACCCGCACCGCGCTGGGAGAGCCATCCTGTCCAACCATGCTTACTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000317G0460 gene.
TTAAACTAATCTCAAAACTTCCTTTCTTCTCTCTTCGGTGTGTGTTTCAAATGTAATGTCCGTAACATTTGAAATTCAAATTCAATTGGAGTTTCTCCTCTCTTTTGAATCCCGGACCTTTTTGAGTTGGGTCTCCCTACTCTTTCGGGCTCAACCCATCTTCTCTCTGGGCCAAGCCCATCTCTTTCGGCCCACCTAGCCTGTTTTTTCTCTGGCCCAACCCCTGCCCTGGCCCGACCTCCCCCTGGCCTTGGCCTTTTCTTTCCCCCCTCCTTTCGTTGGCCCGGCCCGAGCCGCCCGCTTGGGCCATCATCTCCTCCCCCCCCCCTGGGTCAAAGGCTGCAGCGCTGCCTCTCTCTCCCGTAGGCGACGCCATCGCCTGCACCGAGCTACCTACCCTTGCTCCCGCCGCCGGTTCCCCGCCAGTGCCTATGCCCCTGCGCTGCACCCACTTCGCCTACTCCGCAGCGACCGAGGACCCTGTGCCCCCTTCCTCGCCCGGTCTTCTCAGCGCGCCGTGCGGCGCACGTTGCCATAGTCCTCGCCGCTCTGGAGCTCCCAGGTCAAGCGCCGCGTTCTCGTCAACAGCCCCGAAGCCTTGTCTCCCCTCGCCTTGTCTTGTTGCCCGCACGCCTTGGCTCTGGCCGCCATCGCCTTGTCACCTCGGAGCGCCCGCATCGCACACGTCGTCGCCGTCCTCGCTCCTGCATCGAGTCGCGCGCTGCGCGGCGCACGCGCGCGCCCACGTCAGCGTGGACACCCGGGTCGCCGCTCGTCCTCGCTGCGCCTCACCTGCTCCCTCGCCCTGTCCCCTCCATGTGCAAGTCGCCCATGCCGGCACCGCCTCGGGACTACGCGACTCCAACTACAAAGACCTCCCCCCCATTGGCTCTCCTCCTCCTCCATGGCCTATAAAGCGCCTCCTGTGCTCCCTTGAGCTCCTCACGCCGCCCCCTTGGAGTTTCGGTAAGCCACAAGCAAAACCGCCGCTCTCCCATTTT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000317 Download
Protein sequence
Protein sequence
MSGELNNSFDALLVSGGRESGQAQNGGTGTTLSGWKDLPMELLLRIISIAGDNRTVIVGLVASGVCTGWRDALGWGVTNLSLSWCKDHMNDLVISLAHKFTKLQVLSLRQIKPQLEDNAVEAVANYCHDLRELDLSRSFGLSDRSLYALAHGCLHLTRLNISGCSNFSDAALTYLTSQCKNLKCLNLCGCVRAASDRALQAIACNCGQLQSLNLGWCDSITDKGVTSLASGCPELRAVDLCGCVLITDESVVALANGCPHLRSLGLYYCQNITDRAMYSLANSRVKSKGRSWDAAKSSSSSSSRDDKDGLANLNISQCTALTPPAVQAVCDSFPALHTCPERHSLIISGCLSLTSVHCACALHPHRAGRAILSNHAY
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above