gene PH01000317G0080
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000317:51918 - 54493(+ stand)   Name
Alternate name Locus tag PH01000317G0080
Length of gene 2576  bp Length of CDS 627  bp
Product information
Feature type
CDS
Product name
OsMADS2 - MADS-box family gene with MIKCc type-box
Alternate name
Molecular weight
(predicted)
24089.5592199999  kDa
Isoeletric point
(predicted)
8.75590133666992
Length
209  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_169532 3
Please click OG5_169532 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G20240.1
K-box region and MADS-box transcription factor family protein
Floral homeotic gene encoding a MADS domain transcription factor. Required for the specification of petal and stamen identities.
PISTILLATA (PI); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; LOCATED IN: nucleus, cytoplasm; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 8 growth
3E-74
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g66030.1 OsMADS2 - MADS-box family gene with MIKCc type-box, expressed 2E-146
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 180 209
Detailed signature matches
    1. PF00319 (SRF-TF)
    2. SM00432 (MADS)
    3. SSF55455 (SRF-like)
    4. PS50066 (MADS_BOX_2)
    5. PR00404 (MADSDOMAIN)
    1. PF01486 (K-box)
    2. PS51297 (K_BOX)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR11945 (MADS BOX...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0003677 DNA binding
GO:0003700 sequence-specific DNA binding transcription factor activity
GO:0046983 protein dimerization activity

Cellular Component

GO:0005634 nucleus

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 238165 2 80 2.23E-43 cd00265 MADS_MEF2_like cl00109 -
superfamily 241616 2 80 2.23E-43 cl00109 MADS superfamily - -
non-specific 197721 2 60 4.56E-34 smart00432 MADS cl00109 -
non-specific 238067 2 60 4.93E-32 cd00120 MADS cl00109 -
specific 216525 71 170 2.46E-25 pfam01486 K-box cl03234 -
superfamily 216525 71 170 2.46E-25 cl03234 K-box superfamily - -
non-specific 238166 2 63 4.01E-25 cd00266 MADS_SRF_like cl00109 C
non-specific 109379 9 59 2.41E-22 pfam00319 SRF-TF cl00109 -
multi-dom 227400 1 61 2.55E-10 COG5068 ARG80 - C
multi-dom 237254 62 119 0.00981352 PRK12899 secA - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific DNA binding site G2,R3,G4,I6,I8,N13,T15,V19,T20,K23,R24,N26,G27,K30,K31,R33,E34,L38 18 18 238165
specific putative phosphorylation site S59 1 1 238165
specific dimerization interface F21,I28,L29,A32,R33,I35,S36,C39,G44,V46,F48,L54,D56,L64,I67,L68,Y71,N74,S75 19 19 238165
 
DNA sequence
Upstream 1000 bp region from PH01000317G0080 gene.
TATAAGGATCTCTGAAATATTTGCAGATTTTGATCAACTTATCATAACCAAATCAACTACAGTTCTTCATGCTGACACTACCGCAGCGATCAAATTCCTCTTTGTCATACGAAACACACACAAAGCAGTCATGCCGACACTACCGCAGTGATCAATAATTCAAGGATCATTTCAAAAACAAAACTCAATTGGACTCACCTTGATCTAGGAGGAGAGGCGGCGTCCGTGCCAGAGGAGAAGGCGACGTCGGGAGGCGGAGTCGGTGCAGGGGAGGCAGTGGCGTCGGGAGGCGGCGTTGGGGCAGGGGAGGTGGCGCCGTCGGGAGGGGAGATGGGAGGCGGCGGCGTTCGGGAGGGGAGATGGGAGGCGGCGCCGTCGGGGGGGGGGGGGGGNNNNNNAGGGGAGGCGGCGGCGTTCGAGAGGGGAGATGGGAGGCGGCGCCGTCGGGAGGGGAGATGGGAGGCGGCGGCGTTCGAGATGGGAGATGGGAGGCGGCGCCATCGGGAGGGGAGATGGGAGACGACGGTGATGGGGATGGGAGATGGGAGGAGGAGGCGTCAGGTTGGGGACCGAAGGGGTGGAAACGATTGAAAAAATGAAACGGTTTGCAATTATATACTAATAGCATTTTGAGAGAATTTTAACGAAGTTCGGTGGAAAGAGATATTCTATTCCGTAAAAACAAAAAAAACATCTCATTCACGACTTATAACACTTAGATTTAAAATAACTTAAACTTTTTATAAACCGAAAAAACCACCCTCGTATCTTAGATGCCAGGCACCCACGTATCTTAGATGCCAGACATATGATGTAACCCTGTTGTACCTGCACTCAAATCAAATCGGATATCGAAGCAAGCCAACGGAAGCAAAGCGAAGAGAGCATTTGCCGTTTCCGGCTTCCCCCCTGAACTAACCCGAAAGCTCCCTCATCACCATTCCTCTTCCTCCCATGGCGCCCTCCTTTACTCCTCCCCCACCCCCACCACTGCCTCTCCC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGGCGCGGGAAGATTGAGATCAAGAGGATCGAGAACTCCACCAACCGCCAGGTGACCTTCTCGAAGCGCCGGAACGGGATCCTCAAGAAGGCGCGGGAGATCAGCGTGCTGTGCGACGCCGAGGTCGGCGCCGTCATCTTCTCCAGCGGCGGCAAGCTCTACGACTACTGCTCCCCCAAGACCTCGCTATCAAGAATCTTGGAGAAGTACCAGACCAACTCCGGGAAGATATTGTGGGATGAGAAGCACAAGAGCCTTAGTTCGGAGATTGATCGAATCAAGAAAGAGAACGATAACATGCAGATCGAGCTCAGGCACTTGAAAGGCGAAGATCTGAACTCGCTGCAACCCAAAGAGCTGATCACGATTGAGAAGGCACTTGAGAATGGGCTGACGAACCTGAATGAAAAACTGATGGACCACTGGGAAAGGCTCGTGAGAAATGGTAAGATGCTGGAAGATGAGAACAAGTTGCTCGCTTTTAAACTGCACCAGCAAGATGTCGCCCTGAGTGGGAGCATGAGGGATCTTGAGCTTGGGTACCATCCAGATAGGGACTTTGCAGCGCAGATGCCAATCACCTTCCGTGTGCAGCCCAGCCACCCCAACCTGCAGGAGAACAAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000317G0080 gene.
GACGTTGAATACTTTGTGATGGTAACTAAAACAGTGACAAAACTTGATTTGATTTTTTTTAGATAATGAAAGAGAACCTCTCATGGCCTCCGTATCAAAGGATACACACAACCTAAGGTTTATTACAAATATATAAAAATTCATAACCAGGCAAAACAGTAGCCCCATGAGCCATAAAGAAACGGCAAGACTGTAAAAATACAAACCAGTGGCAAAACAAATGTCGTAAAAACAATAAACGTCCTTATGGAAATAAACAATGACTGAAAGTTCGTCAAGCATCTCGAAGCCTATTACATAGTTTCCATCTATTCCTGTTGAATATCTCTCTTGTAATGATCTCTAATGCTTTGCTCAAGACCTTTCTCTTTCCTTGGCATTGCAAAGCTGACCAAGAATGGATCTAATGGATACATATGAATATAACCTACAGAGGATTGTTAATAACTGTCTTATTGAAAACAACATCATTACGATATAACCAGATAGACCAGTATAGTGCAGCCATCCCCACCCAAATTGTTGCTTTTAAATCCGAATTAAGACCTAATAACTAGTTCTCAAAGATATTCTGAATATTATTAGGTCTGTCAAGATTAAAAGCAATCTGAAATATACACCAAGCAAAACGGACAAAGTGACAATCAAAAAACAAATGTTGAATAGTCTCCTGCTGACCACAAAAGTAATAATTTGTGTCACCCCTCCAGTTCCATTTTAATAAATTATCCTTAGTCAGAATAACTTCTCTACAAAGGTAGATTTAACTGAAAATTGTCCAAACCTATGCAAGTTCCACCGAACCGTATCCTTATCCATGGTAAGATGAGCATTGGCTATTCGCACCACAAGATTATTGAAAGCAAGCAACTTAGGGCCAATAATCGCTCTCCTGAAACTCAAATTTAAATGAGTAGTTCCTAAAACATCTACAACCAAAGCATGTTTCTTCCGGACTACCTCAAACAATGTTGGATAAAGTTCATAAAGAGGCCTATGTC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000317 Download
Protein sequence
Protein sequence
MGRGKIEIKRIENSTNRQVTFSKRRNGILKKAREISVLCDAEVGAVIFSSGGKLYDYCSPKTSLSRILEKYQTNSGKILWDEKHKSLSSEIDRIKKENDNMQIELRHLKGEDLNSLQPKELITIEKALENGLTNLNEKLMDHWERLVRNGKMLEDENKLLAFKLHQQDVALSGSMRDLELGYHPDRDFAAQMPITFRVQPSHPNLQENN
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above