gene PH01000298G0920
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000298:676435 - 679684(+ stand)   Name
Alternate name Locus tag PH01000298G0920
Length of gene 3250  bp Length of CDS 1059  bp
Product information
Feature type
CDS
Product name
dnaJ domain containing protein
Alternate name
Molecular weight
(predicted)
38068.29382  kDa
Isoeletric point
(predicted)
8.81277847290039
Length
352  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_126773 9
Please click OG5_126773 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT2G20560.1
DNAJ heat shock family protein
DNAJ heat shock family protein; FUNCTIONS IN: unfolded protein binding, heat shock protein binding; INVOLVED IN: protein folding; LOCATED IN: cellular_component unknown; EXPRESSED IN: 10 plant structures; EXPRESSED DURING: M germinated pollen stage, 4 ant
2E-146
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os05g48810.1 dnaJ domain containing protein, expressed 2E-176
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
  2. Domain
1 50 100 150 200 250 300 352
Detailed signature matches
    1. PF00226 (DnaJ)
    2. PS50076 (DNAJ_2)
    3. PR00625 (JDOMAIN)
    4. SM00271 (DnaJ)
    5. SSF46565 (Chaperone...)
    1. SSF49493 (HSP40/Dna...)
    1. PF01556 (DnaJ_C)
    1. PS00636 (DNAJ_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR24077 (FAMILY N...)
GO term prediction

Biological Process

GO:0006457 protein folding

Molecular Function

GO:0051082 unfolded protein binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 199909 177 338 4.93E-49 cd10747 DnaJ_C cl03262 -
superfamily 243362 177 338 4.93E-49 cl03262 DnaJ_C superfamily - -
specific 99751 4 59 6.53E-11 cd06257 DnaJ cl02542 -
superfamily 243077 4 59 6.53E-11 cl02542 DnaJ superfamily - -
non-specific 216569 265 344 1.42E-23 pfam01556 DnaJ_C cl03262 -
non-specific 215804 4 67 1.60E-17 pfam00226 DnaJ cl02542 -
non-specific 197617 4 62 5.19E-14 smart00271 DnaJ cl02542 -
multi-dom 236757 4 343 1.08E-36 PRK10767 PRK10767 - -
multi-dom 240236 5 352 5.17E-51 PTZ00037 PTZ00037 - -
multi-dom 223560 1 202 3.24E-28 COG0484 DnaJ - C
multi-dom 223560 207 343 3.95E-28 COG0484 DnaJ - N
multi-dom 233829 4 202 7.38E-28 TIGR02349 DnaJ_bact - C
multi-dom 237667 4 349 1.43E-26 PRK14299 PRK14299 - -
multi-dom 184604 4 343 1.59E-24 PRK14283 PRK14283 - -
multi-dom 237657 1 349 5.10E-22 PRK14281 PRK14281 - -
multi-dom 237661 4 202 5.33E-19 PRK14291 PRK14291 - C
multi-dom 233829 212 343 1.39E-18 TIGR02349 DnaJ_bact - N
multi-dom 237664 4 168 2.04E-18 PRK14294 PRK14294 - C
multi-dom 182347 4 314 1.01E-17 PRK10266 PRK10266 - -
multi-dom 237654 216 349 4.28E-17 PRK14278 PRK14278 - N
multi-dom 237653 4 201 1.86E-16 PRK14276 PRK14276 - C
multi-dom 184599 4 209 2.82E-16 PRK14277 PRK14277 - C
multi-dom 237663 1 103 3.32E-16 PRK14293 PRK14293 - C
multi-dom 237668 1 202 1.96E-15 PRK14301 PRK14301 - C
multi-dom 237661 209 349 3.13E-15 PRK14291 PRK14291 - N
multi-dom 172778 1 200 5.66E-15 PRK14290 PRK14290 - C
multi-dom 237656 4 115 1.01E-14 PRK14280 PRK14280 - C
multi-dom 237660 4 203 1.06E-14 PRK14289 PRK14289 - C
multi-dom 237658 3 199 1.28E-14 PRK14284 PRK14284 - C
multi-dom 184603 4 73 2.33E-14 PRK14282 PRK14282 - C
multi-dom 237660 213 349 7.45E-14 PRK14289 PRK14289 - N
multi-dom 184612 4 77 9.23E-14 PRK14298 PRK14298 - C
multi-dom 225124 3 275 1.29E-13 COG2214 CbpA - -
multi-dom 184611 4 200 2.91E-13 PRK14297 PRK14297 - C
multi-dom 237655 216 348 1.38E-12 PRK14279 PRK14279 - N
multi-dom 184603 217 349 1.58E-12 PRK14282 PRK14282 - N
multi-dom 237662 3 117 7.47E-12 PRK14292 PRK14292 - C
multi-dom 237654 1 71 1.28E-11 PRK14278 PRK14278 - C
multi-dom 172774 5 200 1.59E-11 PRK14286 PRK14286 - C
multi-dom 172774 216 343 2.16E-11 PRK14286 PRK14286 - N
multi-dom 234368 4 77 5.37E-11 TIGR03835 termin_org_DnaJ - C
multi-dom 237662 207 343 2.18E-10 PRK14292 PRK14292 - N
multi-dom 172776 1 74 2.47E-10 PRK14288 PRK14288 - C
multi-dom 237663 190 349 2.56E-10 PRK14293 PRK14293 - N
multi-dom 184599 246 343 3.53E-10 PRK14277 PRK14277 - N
multi-dom 172773 213 341 5.57E-10 PRK14285 PRK14285 - N
multi-dom 237664 212 343 1.19E-09 PRK14294 PRK14294 - N
multi-dom 237665 220 348 1.21E-09 PRK14295 PRK14295 - N
multi-dom 237668 244 343 1.38E-09 PRK14301 PRK14301 - N
multi-dom 237665 4 68 2.51E-09 PRK14295 PRK14295 - C
multi-dom 172788 1 117 2.87E-09 PRK14300 PRK14300 - C
multi-dom 172773 1 202 3.48E-09 PRK14285 PRK14285 - C
multi-dom 237659 4 70 5.20E-09 PRK14287 PRK14287 - C
multi-dom 237658 218 343 6.53E-09 PRK14284 PRK14284 - N
multi-dom 237655 4 68 1.88E-08 PRK14279 PRK14279 - C
multi-dom 237666 4 76 3.93E-08 PRK14296 PRK14296 - C
multi-dom 237666 207 349 1.32E-07 PRK14296 PRK14296 - N
multi-dom 184612 216 343 1.15E-06 PRK14298 PRK14298 - N
multi-dom 172778 209 349 3.00E-06 PRK14290 PRK14290 - N
multi-dom 173534 5 76 5.84E-06 PTZ00341 PTZ00341 - NC
multi-dom 184611 244 347 2.36E-05 PRK14297 PRK14297 - N
multi-dom 172776 207 349 9.07E-05 PRK14288 PRK14288 - N
multi-dom 237659 216 351 0.000334008 PRK14287 PRK14287 - N
multi-dom 227694 2 70 0.000395656 COG5407 SEC63 - C
multi-dom 237656 244 344 0.000505093 PRK14280 PRK14280 - N
multi-dom 172788 216 343 0.00656764 PRK14300 PRK14300 - N
multi-dom 237653 212 347 0.0079164 PRK14276 PRK14276 - N
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific substrate binding site R179,K194,K195,M196,K197,I198,S199,E213,N237 9 9 199909
specific dimer interface L274,A275,L278,T279,V300,I301,N302,P303,F334,P335,T336,R337,L338 13 13 199909
specific HSP70 interaction site H32,P33,D34,E44,F47,K48,S51,E52 8 8 99751
 
DNA sequence
Upstream 1000 bp region from PH01000298G0920 gene.
TTCGCCTCCTCAAGCTCCAGCACCTTCTAGGGACACTCAAAACCCTAGTGCCAACATAGACACCCCAAAACAGCATCACCACCCCACGCACTGACGCACATGCACCATCCGCGATCTGAAGCTTTCTCTCCCAGGCCATAAACAGTAGCCCCGACCCACCCACCATTTCCACAACTTCGCCCCGAAACCAATACCTCGCCATCCGCACCATCCTCCTCGAACGGGTGAAACCCTGGATCCGACCCACGTACCGCCTCCCCCCGCCGCTCCCGACGTAACATACCCTATCACCCGCCCTATGTACCTCAAGAGGAAGCGCCTTCTCCCATGGCTGGAACCCTAGCCCCCACCCGCCCGCCGCTTCAATAACTTCGCTCCGCAACACCCGCCGCTTCCTCATCCGCACCACCGCCGCCGTCTTCACAGGGTCGGGCCCCAGCCGTCCGCGTCGACCATGTGGAGCAAATCCTCGGAGAGGGAGGCGGCGTCGCTGCTCCACGCGTCATCATCCCCACGGCTTCGGGCTTCGTTAGGGCGGGTAGGGGCACCATCCGAGACTTCTCTCTCTAACCTTCGTCGGGGAACCGAGCCGACGCGCGGCGGAGCGGGCGATTTGGGGGAGGCGGTCGCTTAGGGCTCGCCGTTTGCGAGAGGAGAGGAGGGGAGATTGGTAGATCTGAAGAGATGAAGAGGAAAGAGCGTGCGGTGCGGGAGGGAAGTAAGATTTCCCAATTTTCTGGGGGGAATTCGCGTGGGCTGAGTTGGCTTGATCCGGCTTTTTAGTGGGCTTTGTTGGGCCCAAGTGGAATTATGTGCAAATCCTAATCCATGTCTTTATCTTTACTACTTAAAAAGAATCTAATGGTGGTGAGTGATACGTTCTTCGCACCCCCTTCAATCCTCAAAAGTTGCAACCTTCGTCTCCTCGAGAAATCGCGTGCCAATGTGTAGACCCGTCCTCATCACCCCGATCCATTGTGGCCTCTTCTCTTTGGAAAAAT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGGCTGGATTACTACAAGATCCTGGGCGTGGACAAGGCCGCCACAGACGACGACCTCAAGAAGACCTACCGCAAGCTCGCCATGAAATGGCATCCCGACAAGAACCCCAACAACAAGAAGGAGGCGGAGAACAAGTTCAAGCAGATCTCCGAGGCCTACGAGGTGCTGAGCGACCCGCAGAAGCGCGCGGTGTACGACCAGTACGGCGAGGAGGGGCTCAAGGGGCAGGTGCCGCCGCCTGGCGCTGGCGGTGCGGGCCCGGGAGGCGCGACGTTCTTCTCGACCGGCGGCGACGGGCCGACGGGCTTCCACTTCAACCCGCGCAACGCGGAGGACATCTTCGCGGAGTTCTTCGGCTCGTCAAGCCCGTTCGGCGGCATGGGGGGAGGACCCGGCATGCGGACAGGCGGCACGAGGTTCTCGTCGTCGATATTTGGGGACGATATATTCGGCTCGGCGTTCGGCGGTGGCACCGATGGGCACCACGGGATGCACGCCGGCGGGAGGCCGGTGAAGGCGCCGGCGATCGAGAGGAAGCTGCCGTGCAGCCTGGAGGAGCTGTACAAGGGGACCACAAAGAAGATGAAGATTTCTAGGGAAATTGCCGATGTCAGTGGGAAAACAATTCCAGTTGAGGAGATCCTAACGATAGACGTGAAGCCTGGGTGGAAGAAGGGCACCAAGATCACCTTCCCGGAGAAAGGAAACGAGCAACCCAACTTGATCCCGGCCGACCTCGTCTTCACCATCGACGAGAAGCCGCACCCGGTGTTCACCCGGGATGGCAACGACCTCGTCGTGACGCAGAAGATACCGCTCGCCGAGGCCCTGACCGGCTACACCGTCCACCTGACGACGCTCGACGGCCGCAGCCTCACGATCCCGATCAACTCCGTCATCAACCCCGGCTACGAGGAGGTGGTCCGAGGGGAGGGCATGCCGATCCCCAAGGACCCGTCGAAGAAGGGCAACCTGAGGATCAAGTTCGACATCAAGTTCCCGACGAGGCTCACGGCGGACCAGAAGTCCGGCGTGAAGAGGCTTCTGGGGCAGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000298G0920 gene.
ATAAATTGTAAATCTCGACATTATTGCTATGTATCTTCTCAATGAGGCTCGCAATTAATCAAACACATAGGCAGATATTTATCACAGGATTTCTCTAGATTGTTGTTTAGCCGTCGGGCCATATACAAGCAAAGTGTCTGTTTCACTGTATAGTAATTTCATACTGAAACTTGATGCACCATGCCAGATTTACAAACATGCTGAATATATTTTCAATACATAATAAACATGCTGGGATCAAAACAGCGCCTTGATTTGATTCCTTGGATCTCGAATGCTTGTCCTGGAAGACGCAGACCTCAGGGGGCTCATGTAGTAGGACAACAATATATGTTCCAGAATGAAATCTTGCACCTCTAGTCTAGAAGGGTCTTCCAGCAGCTTCCATCATCGACTTCGTTTGGATTAGCCTCTCGATTTGCTACTGTAGCCTAGTTGAGAAGCCACATCTGAAATGTGTTGAAAGGTGTTCAACAGCATGTCAGTACAAATTTTGTCGAAGCAACTCTGTCTAGACTCAATGATCTCTGTCGTGATACGGTCACCCCAGCTTGTATTGCTTAAACTTTGCTTCTTCGCACTCCAATGCGGCTTTCTTGCAGGCCCTGATAGTTCCTGAAAGAAGGAAAGGGGTGATCAGCTCTTCTCTGGCATACTGGCCTTGCAAACAGTTTTTTTTTCTTAGTGATATGGCTAAGCATCCAAACTATACATGGAGAAACACCAATAAACCATCAGGCCAAAGTTTGACCAGGGAAAACACTAAGAACTAAGTTTGAGGTCTCAATGTGAACTGACAATGCAACAAACTCAATTATATATGTGTATGTAAAGAAATATGAAAAATTTGACAATGTTATGATTGCTACCAGAAATTCACCTACTGAAAAGCTATAGTTAAGTGCACTAAAAAGACCAGGAAGGATCATGGCATGGTCAGGCCAGTGAGACAAAAAAAGCAAACACTTGGCGGGCATGGCTAGCACCGCCCAGCAATCACA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000298 Download
Protein sequence
Protein sequence
MGLDYYKILGVDKAATDDDLKKTYRKLAMKWHPDKNPNNKKEAENKFKQISEAYEVLSDPQKRAVYDQYGEEGLKGQVPPPGAGGAGPGGATFFSTGGDGPTGFHFNPRNAEDIFAEFFGSSSPFGGMGGGPGMRTGGTRFSSSIFGDDIFGSAFGGGTDGHHGMHAGGRPVKAPAIERKLPCSLEELYKGTTKKMKISREIADVSGKTIPVEEILTIDVKPGWKKGTKITFPEKGNEQPNLIPADLVFTIDEKPHPVFTRDGNDLVVTQKIPLAEALTGYTVHLTTLDGRSLTIPINSVINPGYEEVVRGEGMPIPKDPSKKGNLRIKFDIKFPTRLTADQKSGVKRLLGQ
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above