gene PH01000218G1040
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000218:664257 - 673143(+ stand)   Name
Alternate name Locus tag PH01000218G1040
Length of gene 8887  bp Length of CDS 900  bp
Product information
Feature type
CDS
Product name
ubiquitin carboxyl-terminal hydrolase, family 1
Alternate name
Molecular weight
(predicted)
32625.8661199999  kDa
Isoeletric point
(predicted)
4.77599716186523
Length
299  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP01524680 PH01000218:664777 C C_T
PH01SNP01524690 PH01000218:670619 T T_C
PH01SNP01524700 PH01000218:672892 G G_A
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_127717 3
Please click OG5_127717 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os02g43760.1 ubiquitin carboxyl-terminal hydrolase, family 1, putative, expressed 1E-105
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
1 50 100 150 200 250 299
Detailed signature matches
    1. PR00707 (UBCTHYDRLASE)
    2. PF01088 (Peptidase_C12)
    3. PTHR10589 (UBIQUITI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF54001 (Cysteine ...)
GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process

Molecular Function

GO:0004221 ubiquitin thiolesterase activity

Cellular Component

GO:0005622 intracellular

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 187737 5 185 5.66E-70 cd09616 Peptidase_C12_UCH_L1_L3 cl08306 C
superfamily 244901 5 185 5.66E-70 cl08306 Peptidase_C12 superfamily - C
non-specific 216294 4 185 2.34E-66 pfam01088 Peptidase_C12 cl08306 -
non-specific 187738 5 181 1.06E-11 cd09617 Peptidase_C12_UCH37_BAP1 cl08306 C
non-specific 187736 5 187 0.000499015 cd02255 Peptidase_C12 cl08306 C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic catalytic site Q100,C106,H177 4 3 187737
 
DNA sequence
Upstream 1000 bp region from PH01000218G1040 gene.
AGACCAAAATCCAATCCTTGCCAGCTAACTACGCAGCACCACGCAGCAACCAAGAGGAGAGGAGTTGACTGATACCGCTAGAAGAGGCTCCGGCGTCCCCTCCGGCCTCCGGCGGTGAGGAGGCCATGGACGGCAGCAAGCAGCAAGCTCGGGCAACCGCGAGCGGCGCGGCTCCGGCGATCTAGGGTTTTGCGGGCCCGCGGGGCCTAGGCCGCCATGGAAGCGGCGAGCAGGGCTGCCGCGCGGAAGCCACGGCGGAGCGATCCCCCACGGCCGGCGGCGTGGAGCACGGGAGTCTGCCGCGCGGCGAAGCGGGGACACGGTGGGGACTGCGGGGGGGCGCAAAGCAGCGCCGAAATGTGTTGACGCCGGTCTCGGTATGTGCCACGGGCCGGCGCGTGTGCGTGCCGTGCGGAGACACCGGAGAGCTAGGATGGCGCCAGCGGCTGCCTGTTGGGCTCGGCCGAGGAGAGGTTTGGGCTTCGGGCGCCCGCCTGGAGCAGGCCCAAGAAGGGGAGTAGGCCGCGTGGGATGGGAGTTGTTGATCTGCAGGCCCTTATTGGGCCTCCCGAGTACGGACTACGGAGGAAGCTGTCGAGCCATGGGTGGAATTTAGGTCGGTTTGGGGTTGGGCGCTAGCCGCTATTGGGCCGTAGTCTAGGCGTTGCCTGCCTAATTCTACCACCGGCTGAAGGCTCTGCACAGGAACTTTTTTTATTAATTAACCCTTTTTTTAATTTATTTTTATTGTTAACCCGTAAACTTTATTTTTAATTCTAACCTTTTTGTCACGCCACGGAACAATATTGTCACGTCATAGGATAAATCTGCTAAATAGCACTTTTTGTCACGTCACTGGTGGTGGCGTGACCAAACAACACTGTCACGCCACTAGTGGTAGCGTGATAAGATACGGTACTAGCATGACAACATTTTTTTGTTACTGGCCAAAAGGGTCAGAATTAGAAATAAAGTTTATGAGAGGTTAACCATAAAAATAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGAAAGCGGTGGATCCCCCTCGAGGCCAACCCCGACGTCATAAACCAGTTCATGTGGGGACTGGGTGTCTCCGAGGAGGAGGCGCAGTTCTCCGACGTCTACGGCCTCGACGACGAGTTGCTCGCCATGGTGCCCCAGCCCGTGCTCGCCGTCCTCTTCCTCTACCCGCTCACCTCCCTGGGTGATGAGTTTGTTGCTTTATGGAGCGAGCAGGACGATGAGGAGGAATCCGATGCTTCTGCCACTTCCACGGCCGGGGGCAAGGATTCAAGCAAGAAGGTATACTTTACAAAGCAGACTGTTGGCAACGCTTGTGGAACAGTTGGTGTTATTCATGCAATAGGGAACGCCGCATCCAAAATCAATCTGGTTGAGGGGTCATATTTTGATAGGTTTTATAAACAAACAGCTGATATGGATCCAGTCCAGCGTGCTGCCTTTCTTGAGGAGGATGATGAGATGGAGGATGCTCATTCTATTGCTGCTTCTGCCGGTGACACTGACGCCAATGTTGAGGTGAATGAACATTTTGTATGTTTCTCTTGTGTTGATGCAAAGTGTGAGGCCACTACCGACGAGATCAAAGCCTTCCTCAACAAGATCCTCACAAGGCTAAAGAAGATAAGTGCAGCAATCGAGGAAGATGTTGTATTGCCCTTGGTTGCACCATTAGTGCCTTCGTCGAGGGAGAATATTGTCGCTGTATCGTGGCCATCTTCGCACAGTCGACTAACGTGCCATTGGAGGGGTGGTGCACAACAGAAGCATGGAGGATCACGACATCATCGCATTCTTCCTATCATTGTCGCACTCTTACCACCGTCACTCTCTGTGGCAAGAAGGGCACCTTCGCTGCCCCATGCCATCGGTGACCTCTTCGACCCCAGGCAGTGCTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000218G1040 gene.
ATAAATAAATGAGGATTATTATATCCTCGTTATCTAGCCACATAGCTTCAAGTGAAAATAACTTACTTGGAAAAGGCAGTCATAGAAGGCCTTACGACCACAAAGTAGTCGTAGAAGGTCTTACAACCACAAAGTAATCGTAGAATGATGGTTAGAAGTAAAAGCCTTTCCGACTGGTATTTCATTTTGACCAGAAAAAAGACTTGGTCAAGAAGGTAATTTCGCTTGTGGTGTGAAGACAAACTCGGTTTTCTCGAATAGACAAATTAAAGAATCTCAATCGACTCTCACAAATCTGTCCGTTGGAGTGGTTCCTGAAGAGGTGGCAACTGTTGAGTTCCCACGATCTTTAACTCAATCGTGCGATTATAAAAACTTATCGCGGGCATGATTCTAGGGTTCTTACTTTTTCCCTTTGCTTCAACTGTTCCTCGAGCTCTTGCGTTCTCTGCCGCCAACCAAATCACCTTCTTCCTCAAAGCTTTTCCAAATCTAATCTAACCTCACCTAGAGAAAATGGCCGGAGCTGCTTCTAAGTGGGCGGAATCAGAGATGGATTCAGCCAAGATAAAAGCTTTGGTCACTGCCGAGAAGATCCTGAAGAGAGAATTCGTGAAGTGGATTGAAGCTACCGGGCAACACTGGCCGTCGAGGGAGATTGGTCAGATTCCCGTTTTTTAGGCACACTGTGAGTGTGGCCTTCAGCTGCCCGCTCATCCCTTTCTCACACTCGTACTCAAGCACTTTGGGGGTGGAGTTGGTGAACCTAGTTCCTAATTCTATCATAATGTTGAGTGTATTCGTGTACTTGTGCGAAGCTTATCTTGGGATTCTTCCAGACTTGGAGTTGTTGTAATACTACTATGGAAGAGTTCCAGACTGGGAGTGATCACTGCCTCCTTGTTCTTCTTTTCAACCCTCCTCTCTATCTCTCTCAGTCATGGAGAAACTCCCCTTGCTCCTCTGGGACCCCCTCGGTTTTGGACCTCCCCCTTGTTGGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000218 Download
Protein sequence
Protein sequence
MGKRWIPLEANPDVINQFMWGLGVSEEEAQFSDVYGLDDELLAMVPQPVLAVLFLYPLTSLGDEFVALWSEQDDEEESDASATSTAGGKDSSKKVYFTKQTVGNACGTVGVIHAIGNAASKINLVEGSYFDRFYKQTADMDPVQRAAFLEEDDEMEDAHSIAASAGDTDANVEVNEHFVCFSCVDAKCEATTDEIKAFLNKILTRLKKISAAIEEDVVLPLVAPLVPSSRENIVAVSWPSSHSRLTCHWRGGAQQKHGGSRHHRILPIIVALLPPSLSVARRAPSLPHAIGDLFDPRQC
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above