gene PH01000207G0510
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000207:391529 - 394018(+ stand)   Name
Alternate name Locus tag PH01000207G0510
Length of gene 2490  bp Length of CDS 1068  bp
Product information
Feature type
CDS
Product name
peroxidase precursor
Alternate name
Molecular weight
(predicted)
37879.32022  kDa
Isoeletric point
(predicted)
6.81481552124023
Length
355  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_173739 10
Please click OG5_173739 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT5G42180.1
Peroxidase superfamily protein
Peroxidase superfamily protein; FUNCTIONS IN: peroxidase activity, heme binding; INVOLVED IN: oxidation reduction, response to oxidative stress; LOCATED IN: plant-type cell wall; EXPRESSED IN: 10 plant structures; EXPRESSED DURING: 4 anthesis, C globular
2E-94
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g22370.1 peroxidase precursor, putative, expressed 4E-177
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
  1. Domain
1 50 100 150 200 250 300 355
Detailed signature matches
    1. SSF48113 (Heme-depe...)
    1. PR00461 (PLPEROXIDASE)
    1. PS50873 (PEROXIDASE_4)
    2. PF00141 (peroxidase)
    3. PR00458 (PEROXIDASE)
    1. PS00436 (PEROXIDASE_2)
    1. PS00435 (PEROXIDASE_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31235 (FAMILY N...)
GO term prediction

Biological Process

GO:0006979 response to oxidative stress
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004601 peroxidase activity
GO:0020037 heme binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 173827 30 331 4.05E-171 cd00693 secretory_peroxidase cl00196 -
superfamily 241676 30 331 4.05E-171 cl00196 plant_peroxidase_like superfamily - -
non-specific 215545 27 332 2.85E-87 PLN03030 PLN03030 cl00196 -
non-specific 215745 46 199 2.04E-65 pfam00141 peroxidase cl00196 -
non-specific 173823 46 313 2.24E-27 cd00314 plant_peroxidase_like cl00196 -
non-specific 173825 46 311 7.36E-11 cd00691 ascorbate_peroxidase cl00196 -
non-specific 173826 65 312 2.22E-06 cd00692 ligninase cl00196 -
non-specific 215745 265 296 0.0075707 pfam00141 peroxidase cl00196 N
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific heme binding site G59,A62,G63,V65,R66,F69,N98,S101,R103,P167,S168,P169,L176,F180,M190,L193,S194,A196,H197,I199,G200,V201,S202,R203,S206,M251,F274,S276,M308 29 29 173827
specific active site G59,A62,G63,V65,R66,F69,H70,S101,R103,P167,S168,P169,L170,L176,F180,M190,L193,S194,A196,H197,I199,G200,V201,S202,R203,S205,S206,M251,F274,S276,M308 31 31 173827
specific substrate binding site R66,P96,P97,P167,S168,P169,L170,R203,S205,S206 10 10 173827
specific calcium binding sites D71,V74,D78,S80,T198,D252,T255,V258,D260 9 9 173827
 
DNA sequence
Upstream 1000 bp region from PH01000207G0510 gene.
ATCGCTCTGAGCTCACAAAGGAGTAAACAGTGAACACAGCCTAGTTGCAGGGAAGTAGCTAGACCTGTCGAAATAGGCTGTGTCTATCAGGTCAGCTCGAAGCACGACACTATTGGCCCAGTCTAGACCGAGCACAGCCTGACGTACCGTGCCGTACTTGGGTTGTGACAGCAGCCCAGCGGTCTATCCCGACACGACATGTATAGTATTGTGCCTGGCACAACCCATTTAGCATCGGTCAGCCTATTAGACACGATTAGGCACGGCACAACACAACCCGATAGGCACGATTAGACTTGTTTAGCATCGGTCAGCCTGTTTTGCTTTCCGACACGACACGTATAGTATTGTTCCTGGCACAACCTGTTTAGCACAGGTCAAGCCTGTTAGACACGATTAGGCACAGCACAACACAACCCGATGGGCACGATTAGACTCGTTTAGCAACGGTCCACCCGTTAGGCATGGCACGATATGACCCGTTAGGCATGGTTAGACCCGTTAGACACGGTTTTAATTTACATTTTTGAATTCTATACATTTTCCTAGAATTTTGCAATTTGTCAAAGTTTTCGGGTCGAAATGGGCTGAACAGGACAGCCCTGGCCTGTCAGGCTAATCGTGCCATACCGACATGACACATCCCATAAACTCAGTGTGCCGTGCCGCCTGTGGGTTGCCCCCTGTGTCAGCAGCTGAACCCACAAGCTAACACAACGCAGCCCATTTAACTAGCCGAGCCGTACCTAAACAGCCCCATCCGGGCCGTGCCGACAGTTTGGACCGGTCTACAGGGAAGCTTCAATCACACATGGGGCCTGACTGGTTGTAGTATGACAGGGAGCATGTACATATGTTCACAAAGAAGAAAAGCAAGGCAAGTACATATGTTCACAAAGAAGAAAAGCAAGGCAAATGGCACCACTTGTGTGCTGCTAGCTTTTACACCTGTTTTGACAAACTGCCCCTTCATTTCACATGGAAAAAACCACTCCAGTGTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGAGCTCCCTGACCATGAAGTGCTTGTGCTTCACCTCAGCACTTGCCATCCTTGCCCTTTTCCCGGTTATCGCTGTTGGCGCTGACCTCAAGGTCGGGTTCTACAGCAAGACCTGCCCATCAGCAGAGACCCTGGTGCAGCAGGCAGTGGCTGCAGCCTTCAAGAACAACAGCGGCATCGCCGCGGGCCTCGTCCGGCTGCACTTCCACGACTGCTTCGTGAGAGGCTGCGACGGCTCAGTCCTTATTGACTCGACGGCAAACAACACTGCGGAGAAAGATGCACCCCCCAACAACCCTAGCCTCCGTGGATTCGAGGTCATTGATGCTGCAAAGAAGGCAATCGAGGCCCAATGCCCCAAGACAGTCTCTTGCGCTGACATCCTTGCCTTCGCTGCCCGAGACAGCATTGCGCTAGCAGGTAATGTAACTTACAGAGTACCCGCAGGGCGCCGCGACGGCAGAATATCCATTGATCAGGATGCCCTCGACAATCTCCCCTCGCCGCTCTCAAACGCGTCTGAGTTGGTCGGCAACTTCACCCTCAAGAACCTCACTGCCGAGGACATGGTCATCCTCTCTGGCGCTCACACCATAGGTGTCTCGCGCTGCTCATCCTTCACGAACAGGCTCTACGGCTTTAGCAACACCAGTGAGGTTGATCCTACAATAAGCTCTGCCTATGCCTTCCTGCTCAAGAACATATGCCCTGCCAACAGCAGCCAGTTCTTCCCAAACACAACGACCGCGATGGACATCATCACCCCGACGGTGCTCGACAACAAGTATTACGTGGGTCTGACAAACAACCTAGGCCTGTTCACATCAGACCAGGCATTGCTCACAAACTCGACTCTGAAAGCATCAGTTGACGAGTTTGTCAAGAGCGAGAAAAGATGGAAGAGCAAGTTTGTCAAGTCCATGGTTAAGATGGGCAATATCGAGGTGCTAACAGGAACGCAAGGAGAGATTAGGCTCAACTGCAGGGTCATAAACAGAGGGAGTACTGGTCTTGAGCTTAGGACTGGCCCTGACTCTGGTGAAATCACTGAAATAGCAACAAGCTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000207G0510 gene.
ATAAAAGAAAACAACCATACAAAAAAACCTGGGAAAAAAATATCGTTCTGTTTTCTGTTTTGTCTGGTGTTTGGATTAGTGTTTGCGGTACTAATGGAAGAAAATAATTTACGATGAAATGTTGCTCACCGGAATAATGTGTTGTGCATAAGATGGCAATGGAATGGACTATTGTGTTCTTTACAATATCTTCTCCCTAATACAGGAAATAAGAAGGATGCTGGGGGTACTTTCCCACAATATCCACTACACCATAGTCCATATTACAAATTTACAATGACATAGTTAATGGTTGAGATATGGCCCTATCAAGCACAACCTACAACTAGAGCAAGCCAGAAGCTTACACCACTGCTACAGCAGCACTAGCACACACTTACATAGCTCTACCAAGCACAACCTTAAACCCTTCGAGCCTAAACCACTAAGTCAGGCACCCACCCTATCACGGCTTCGCAGCACCATGAATGCCAACCACGCCGCCACCGGGCGTCAACGGCGAACCACCAATGCCAGGGAAGGAGCTAGAACCCGGCATCCCACCGAAGCCGACCTGTGGGGTGACGCCGTTCGGACCTGGAAAGACCCAGTTGATCGTCGGGCCAGGGTAGAAGCCACCGAACCCAAAGACGTTCTGGGGCCGGTAGGGCTTGGGCTCGGCTGGGATGTCCCTTGCACCATGGCACGCAAGGCAGGCAGCAAGCAAGAGGCCAAGAACAAGGTTCACACTAACACTGCTACCTCTCTCCATTGCTACCGCTTTGGCTTACAGACTCGGATTGGCTTGACAAGAACCTAGGTGCTCAGCCCCTTCATTTATAAGCAGTAGTTCACAGTGCATGGTTGGAGTTGGAGTCTTTATGGATGACATAATGAGCACCAACTGACCAGTAGCAAGGGCATGTTTGGCTGAATGTGTGACCTATGACTGAAAGGTGGGCCCAATATGCGTCTTTTTCCAGTAGCACCAGTCTTGTTTTTTTTTTTTTTTTGCAGAAACA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000207 Download
Protein sequence
Protein sequence
MSSLTMKCLCFTSALAILALFPVIAVGADLKVGFYSKTCPSAETLVQQAVAAAFKNNSGIAAGLVRLHFHDCFVRGCDGSVLIDSTANNTAEKDAPPNNPSLRGFEVIDAAKKAIEAQCPKTVSCADILAFAARDSIALAGNVTYRVPAGRRDGRISIDQDALDNLPSPLSNASELVGNFTLKNLTAEDMVILSGAHTIGVSRCSSFTNRLYGFSNTSEVDPTISSAYAFLLKNICPANSSQFFPNTTTAMDIITPTVLDNKYYVGLTNNLGLFTSDQALLTNSTLKASVDEFVKSEKRWKSKFVKSMVKMGNIEVLTGTQGEIRLNCRVINRGSTGLELRTGPDSGEITEIATS
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above