gene PH01000177G0450
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000177:274972 - 279084(- stand)   Name
Alternate name Locus tag PH01000177G0450
Length of gene 4113  bp Length of CDS 1281  bp
Product information
Feature type
CDS
Product name
AGAP000554-PA
Alternate name
Molecular weight
(predicted)
47112.31452  kDa
Isoeletric point
(predicted)
8.37036514282226
Length
426  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_128655 2
Please click OG5_128655 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT3G47610.1
transcription regulators;zinc ion binding
transcription regulators;zinc ion binding; FUNCTIONS IN: transcription regulator activity, zinc ion binding; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 14 growth stages; CONTAINS Int
3E-115
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os09g24660.1 AGAP000554-PA, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 300 350 400 426
Detailed signature matches
    1. PF06221 (zf-C2HC5)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR12963 (THYROID ...)
  2. PTHR12963:SF0 (SUBF...)
GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-dependent

Molecular Function

GO:0008270 zinc ion binding

Cellular Component

GO:0005634 nucleus

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 218944 174 215 3.44E-21 pfam06221 zf-C2HC5 cl05634 C
superfamily 218944 174 215 3.44E-21 cl05634 zf-C2HC5 superfamily - C
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000177G0450 gene.
CAAACTAACCATACAGTTTTCTTTGTCAAGCCTTGCATAAATGTTATTGCATTCACTTTCCCTATGGCTTGCTGAGTACATTCAAAATACTCATGACTTGTGCCCTCTGGTTAATCAGCAGCCGAAGACCTCCCCAGGTGCTCCGAGCACTACGAGGAGGAGTTCGTTAAAGACCTCGTAGACTAGGGGACGTCCTCCACTCGATAACCTGTGGCTCGCCGAGTGGCTCCGTGTTGTACTTTGTTCTGCTGCAAGTGTTCTTTTTGCTGTTAGCCCTGCGTAGCACCCCTGTAAACAAGCTTGACCGTAAGGTCTTTTGTCTATAAATATTAATTTGTCTGCTTCATCTTAAGTTTGTTGTATGGATGTGATAACACCGATGTTGGGTCTGTGCGAGCTAGCAATCTGATCTTGGAACTAGCTCATTGTGCACAGAGACTGAGACATCCGAGTGGTCTTGGTGGACCTCCGGGTGGACCTTCGAGTCCTCCTGGGTGGTCCTAGAGGCTCTCCAGGAGGTCCTAGGGGACCTCTTGGGAGGTCTTGGAGGACCTTCCAGACCTCCAGGTGGTTCGGTTGGACCTCCTGGGTGGTCCTGGGAGATCCCTCCGGATCCTCTCGGGTCGGGTCCTTACACAACGGCATGGTCCTGTCAGCATCAGGGCCAAGATCCACGGCGGCCGGTGGAGTCTCCCGATGGTTGTATGGGTTTGAACCTACCGGGTAGAGATTAGAAAGGTCGAGCAGTGAAAAAGCTTTGTTATCTCAGCTCAGTTGCACGCTAACGTGTTACGTGTCTATGTTCTGACAGTATGAGCATGAGATATCTTGTGGGTAAAGTTGGGCAACTCTGCAGAGTGAATAATTAAAGGTATTCGAATACGTCGTGCTTCCGGTTAATGAAGTTGTGTTAATGGGTGATTCCAATACAAAGGCATAAGTAGAGTTTTTGAGATGTTAAGTTGGTAAATGAGTTTGTTGAGAAACCCCTAATGTTATTA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGACAAACTTCATCGAGCTGTGCACTTTGAGGTCGGTGACTGGGTATGGCTTCGTCTTCATCATTGTTCGGCAGTTGGCATTACCAATCCGCAGCGCTCCAAGTTGGCTCCACGGTTTTACGACCCTTTTCTCGTTCAAGAACGTATTGGATCCGTGGCCTATCGTTTTCATGTCGCTCTTCTCAAACAGTATCAAGAACATTATTGGAGTAGAAGCTGCTCAGGACCTTATTCAGGAGTATTTGCAGAGGAGGGGTTACATTGATCCCTCGAATGGAACTGAAAGCTTGCTGTCGTCTAACCTTCAGCCTTATGTGAAGCCATCTGCTGATGCAGCAACTACCCAAACAAAGAAACAAACACGTACACAAAAAGATGCAGCATCTTCTTCTAGTCAGAGTTCCAAGAGTCAATCAGAGACTGCTGAATCCCGAGTTGCTTCCAAGAGAGGTCCAAAAAAGAAAGGAGTAAAGGCCATCTCCCTCACTGAGGTAGCGAAGGGTTCTATTGTCTTCAAGCAGGGGAAACCTTGTTCATGCCAAGCGCGCCAGCACAATCTTGTTAGCAACTGCTTATCGTGTGGCAAAATTGTGTGTGAACAAGAGGGCGAGGGACCCTGTAGTTTCTGTGGTGCACTTGTCTTAAGGGAAGGCAGTACATATGCTGGTTTAAGTGATGTTGGAGTTCCTCTTTCGGAAGCAGAAGCTGCAGCTGAAGCGTACACAAAGAGGCTTGTTGACTATGACAAAAACTCTGCAGCAAGGACTAAAGTTTATGATGACCAAAGTGACTATTATGAAATGGAAGGAAATAGTTGGCTTTCTTCAAAGGAAAAGTCAGACCTAAAAAAGCAGCACCAGGAAGCTGAGGACGCAGCTGAAAAACAAAAAGGAAAAGTGATTGTCACATTTGATTTGGTGGGTCGTAAGGTAATTTTGAACAAGGATGAAGCCACTAAGTTGGAATCTGAGCACCGGATCTTGAGACCACCTGAAGAGAAGGATCAGAGTCACCGCATACAGCCCAACCCCACAATCGGAGAGCAGCCAGTGTTCATCGAAACAGGACCAGTGAAGCCGAAAACCGACAGAGTAAAACAGAGCAAGAGGCTCGCCAAGAATGGCTTGTGCCTGGAAGTAACTGGACGGCTGCAGCACGACGACAAGGACCTCCAGAGCTTTCTGGGTGGCAAGATGAAGAAAGGCGATCATGTGGCGTACAGTTCCTTCGGTCAGGTTCGCGAAGGGGATGACTACGAGTGCTCCCTTGATTTTGATTGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000177G0450 gene.
GTTTTTCTGACAAATTACACATCCTTTAATATAATCCTGGACCCTCCGGTGAGCACCCGCATTGAAGAATGTAGCACGAAAACGATGCAAGGTCTTTTGAATGCCTTCATGACCTGTATTGTGCGCATCAACGAGTAAATCGACCCAAAGAAGAGAAGAATCTGGCACAAAAATTCGTCCTTTGAATAAGAGTAAACCATCAACCAATGTCCAAACCAGTTCGACTGTGCTAGCCGAAACCTGATCCCGAAGAGCAACCAATTCTGGCAAATAAGCAACCTCCTGCTGAAGAGCGGCAAACATGGCAAAAGTGGGACCAGAGATGGTGCACACTGCGACGGTGTCTTCATCACGGCAAGATAAGGCGTCTACTGCAGTATTCTGACATCCTAGCCGAAACTCCATTGAAAAATCATAACTGAATAACTTGCTCACCCATGTATGTTAAGGAACAGTGGAGTGTCGTTGATCGAGTAAGAACTTTAAGCTATAGTGATCCATTCGAACCAAAAACGATCGTCCCCAAAGATATGGACATCAACGACGCACAGCCTTGACCAAGCCAATCAACTCGTGCTCGTACGTCGCTAACTTAGCATGGTGAGGAGCGACCGCGCGGCTGAAGAAAGTAATCCACCCTCCTCCTTGATGCAGAACCGCACCAAAACCGGCGCCAGATGCATCACAATCTATCGTAAAACGTTTGGCGAAATCAGGAAGATGCAAAACTAGGGCCGAAACAAGAGCAGTCCCCAAGGCTGTGAAGGCGGTATCAACATCAGTGGTCCAAGAGAAAGCCTCCTTCTTGAGCAATTAAGTGACGGGTGCCGCCACTACGCCATACTCCTTGATGAATTTTTGGTAGTATCCTGTGATACCGAGAAACCCCCGAAGTGCACAGATGGAGCGCGGCGTCGGCCAAGCCTGAACAGTGTCAACCTTGTCGAAATCCATGGCCACGCCTTGGCCGGAAATAATGTGGCCGAGATATGCCACAGACT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000177 Download
Protein sequence
Protein sequence
MTNFIELCTLRSVTGYGFVFIIVRQLALPIRSAPSWLHGFTTLFSFKNVLDPWPIVFMSLFSNSIKNIIGVEAAQDLIQEYLQRRGYIDPSNGTESLLSSNLQPYVKPSADAATTQTKKQTRTQKDAASSSSQSSKSQSETAESRVASKRGPKKKGVKAISLTEVAKGSIVFKQGKPCSCQARQHNLVSNCLSCGKIVCEQEGEGPCSFCGALVLREGSTYAGLSDVGVPLSEAEAAAEAYTKRLVDYDKNSAARTKVYDDQSDYYEMEGNSWLSSKEKSDLKKQHQEAEDAAEKQKGKVIVTFDLVGRKVILNKDEATKLESEHRILRPPEEKDQSHRIQPNPTIGEQPVFIETGPVKPKTDRVKQSKRLAKNGLCLEVTGRLQHDDKDLQSFLGGKMKKGDHVAYSSFGQVREGDDYECSLDFD
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above