gene PH01000162G1010
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000162:704333 - 712246(+ stand)   Name
Alternate name Locus tag PH01000162G1010
Length of gene 7914  bp Length of CDS 591  bp
Product information
Feature type
CDS
Product name
YABBY domain containing protein
Alternate name
Molecular weight
(predicted)
21705.5274199999  kDa
Isoeletric point
(predicted)
8.77598190307617
Length
197  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_156329 2
Please click OG5_156329 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT2G26580.2
plant-specific transcription factor YABBY family protein
YABBY5 (YAB5); CONTAINS InterPro DOMAIN/s: High mobility group, superfamily (InterPro:IPR009071), YABBY protein (InterPro:IPR006780); BEST Arabidopsis thaliana protein match is: Plant-specific transcription factor YABBY family protein (TAIR:AT1G08465.1);
6E-53
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os12g42610.1 YABBY domain containing protein, putative, expressed 2E-90
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
  1. Domain
1 20 40 60 80 100 120 140 160 180 197
Detailed signature matches
    1. PF04690 (YABBY)
    1. SSF47095 (HMG-box)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR31675 (FAMILY N...)
  2. PTHR31675:SF0 (SUBF...)
GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 113458 9 167 9.25E-72 pfam04690 YABBY cl04677 -
superfamily 113458 9 167 9.25E-72 cl04677 YABBY superfamily - -
non-specific 238686 121 157 0.000150128 cd01390 HMGB-UBF_HMG-box cl00082 C
superfamily 241597 121 157 0.000150128 cl00082 HMG-box superfamily - C
non-specific 238037 121 157 0.000368407 cd00084 HMG-box cl00082 C
non-specific 189580 121 157 0.00758298 pfam00505 HMG_box cl00082 C
non-specific 197700 118 157 0.00780399 smart00398 HMG cl00082 C
Conserved sites/feature
(0 result)
Type Brief name Coordinates Complete size Mapped size Source domain
 
DNA sequence
Upstream 1000 bp region from PH01000162G1010 gene.
TTGCTCGGGGGGCAAGGCAACTCAATCTTATATCATACATAGCATGGTCCAAATCGAATGAGTGAAACAACCACCACATCACAGCGCCCTATGTACGCTGCTCTGGTCTTGGTAGGGGCACGGTCGCTAATTGGAAATAACACAAATCAATCCCCTCGGGACCCTCAAGAATAGTCCCCTAACCGTAAAATTTTTTTAAGTTGATGGCGTCCGATATATTTGATGTACTGTACCGTAAACAAGATTTCCACGATTAGCCACATATCTAAAACTAGACTACCCACCGAAAAGGATTATGTACAACATACTACACTACGTAACCGTACATCCAAAACTATGTAATCCATTCGGTTAAAAGAATTACCTGAAAGGTGGGCGACCGGATGGACAGCGATTTGCTAACTTTTCTTCCCCCTTCTACTCCTCTCCCTTCCCTCCCTCTCTTTCTTTTTTCTGAATAAAAGTGTGTTTTCCTTGAATTTTAGGGTTTCAAAGGTCTTTTATAGGGAAGATTGTATTGTCATTTGAAATGACGATAGGGACTCGCGAGATCCCTATTGCCAATTGAAATGGCGGTTTTCTAAATTTTAATATTAAAAAAATTAAGGATTCCTGTCGCCAATTCAATTAGCGAAAGAGAGCTCTGGGTACTGTTAAGCTCTCTATCGTCAGTGGCCAAACCAGGCACGTAGTTTTGTAAAAAAAAAAATCAACTATTTATTTTTGTAATTACCTTTTAAATTATTATTATTATTTTAAAAAAAATCGCGAGAGAGGCACGGGGGTGGACGGGTATCTCGATCTCCCACCCACTCATTGTTGCAATCATTCATAGCACAGCACACAGAGCATTTCTCATATATCCTCCAACGCTTCGACATGAGCCACAACAAATAAAAGCACTATATTGCTTTGCTTGCCCCCACACTGCCCTCCCTCCCTTACTACCTAGCCAGTACTTCTCCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGTCGGCCCAGATCACGCAGGCGGAACATGTGTGCTACGTGCACTGCAACTTCTGCAACACAATTCTCGCGGTGAGTGTCCCGGGAAATAGCATGCTCAGCATTGTGACCGTTAGGTGTGGCCACTGCACAAATCTACTGTCAGTGAACTTAAGAGGACTGATGCATTCAGCCCCAGTACAAGATCATCTCCAGCAGGAGAATCTCAGCAAGGTCCATAGTACCAGCGGCTTCCGTGATCAAAGTGGTCATTCGGAGCTTGGTTCTTCGTCCTCGAGATTCGGGCTGCCTATGATGTACTCGGCACAAAACGACCAGGAACAAACGCTACATGCACACCCTCCGGCGGACAAGAGGCAACGAGTTCCTTCAGCATATAACAGATTCATTAAGGAAGAGATACGAAGGATCAAAGCAAACAACCCCGAGATTAGCCACAGGGAAGCATTCAGCACAGCGGCGAAGAACTGGGCACATTATCCAAACATCCATTTCGGGCTAAGCCCCGGCTGCGAGGGCGGTGGCAAGAAGCACGTCGACGAAGCCATCGCCACCGCGCCGGCTCCCAAGAAGATCCAAGGTTTCTACTCA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000162G1010 gene.
AATATTGTTGTGAACTTGTGATATGTTTGAAGCTAGCTAGCCTTCCAGAGATATATTTGCAAAGGGAGGGAACTAGTTGATCGATACATATCGCATTAACTAATTCAGGTTTTTAGCTCACACATATGCGTGGGTTTTGATTGACAACTCAGGTTTTTACTAGCTATATATAATAATATACATGCAAGATTACCTAGAGTTGTTCGCCACTGTGTGGAGTTCACTCGCTCAATCTCGTTCATTTGTTCGTAATTCCAGTTATCAACTTCCAAATATTTCATCTGGTACATTTTTAGTACTTAGATATTCTTATTGACCTTCTTTTGAGCATTAGGATCTATGGGTAATTGCAGTTGAACTCCACTTGGTTTACAGATTAGCAGTTGAGATTCAGAGTCTTCAAACATATTTATCATGTATACGTATGCACAACATGGAATTAATGAATGTTCATGTGTGTGTGTAGTTTAAGCCAGGTAGTACCTAGATTTTTTTGTTTTTGATCATCCAACAATATATATACGTTGGTACTCATCTCATCTGGTTTGTTAAGAGTTGGAAATCTAGTTTTGGTATAGCACTATACGGCCTATATATCTCCAGCCTATTTAGAACGTGGGAGCTCTGTAGGGATTCCGCGGGAAAGGAAACATGCACCCACTCTCTCGCTAGATGTGGGGTTTCCCTGCGAGATTATTCCTGCGGGCCACGGCTATTCAATATCATAACCAGCAATATCAGAGCTATGTATGATACCACAATTAACACCGAATGCTAGCTGTGGATCCTAGAGTAACAGGAATATAGCTTTCACCCCATGTGGATTATGAACAAAGCATTTAAATTTGGCTCTCATAAATAGAGAGAAGAGGTAACTTCAACTAGTATAACAATCTATCAGTAAGCTAGTGTTCTCCAGCCAAGCAGGCAGGGAGGCAGAGAGTTTCTGCCATTGTCCAGGCACGGTCAGCTCGGTTCTCCATGAAACTGTTAAAACTGAC
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000162 Download
Protein sequence
Protein sequence
MSAQITQAEHVCYVHCNFCNTILAVSVPGNSMLSIVTVRCGHCTNLLSVNLRGLMHSAPVQDHLQQENLSKVHSTSGFRDQSGHSELGSSSSRFGLPMMYSAQNDQEQTLHAHPPADKRQRVPSAYNRFIKEEIRRIKANNPEISHREAFSTAAKNWAHYPNIHFGLSPGCEGGGKKHVDEAIATAPAPKKIQGFYS
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above