gene PH01000162G0280
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000162:228128 - 233366(- stand)   Name
Alternate name Locus tag PH01000162G0280
Length of gene 5239  bp Length of CDS 1992  bp
Product information
Feature type
CDS
Product name
serine/threonine-protein phosphatase BSL2
Alternate name
Molecular weight
(predicted)
71678.8307200002  kDa
Isoeletric point
(predicted)
5.38647842407226
Length
663  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP01169710 PH01000162:232694 A A_G
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_132764 7
Please click OG5_132764 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT2G27210.1
BRI1 suppressor 1 (BSU1)-like 3
BRI1 suppressor 1 (BSU1)-like 3 (BSL3); FUNCTIONS IN: hydrolase activity, manganese ion binding, protein serine/threonine phosphatase activity, phosphoprotein phosphatase activity, iron ion binding; INVOLVED IN: biological_process unknown; LOCATED IN: cyt
0
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os12g42310.1 serine/threonine-protein phosphatase BSL2, putative, expressed 0
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
1 100 200 300 400 500 600 663
Detailed signature matches
    1. PF00149 (Metallophos)
    1. PR00114 (STPHPHTASE)
    2. PS00125 (SER_THR_PH...)
    3. SM00156 (PP2Ac)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR11668 (SERINE/T...)
  2. SSF56300 (Metallo-d...)
GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0016787 hydrolase activity

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 163662 307 609 0 cd07419 MPP_Bsu1_C cl13995 -
superfamily 246597 307 609 0 cl13995 MPP_superfamily superfamily - -
non-specific 163657 307 610 7.91E-98 cd07414 MPP_PP1_PPKL cl13995 -
non-specific 163658 330 600 1.02E-84 cd07415 MPP_PP2A_PP4_PP6 cl13995 -
non-specific 163613 358 596 2.92E-67 cd00144 MPP_PPP_family cl13995 -
non-specific 163660 339 600 5.86E-63 cd07417 MPP_PP5_C cl13995 -
non-specific 163659 339 594 6.46E-63 cd07416 MPP_PP2B cl13995 -
non-specific 163663 339 601 1.31E-46 cd07420 MPP_RdgC cl13995 -
non-specific 163661 319 596 1.26E-39 cd07418 MPP_PP7 cl13995 -
non-specific 223712 433 585 1.56E-12 COG0639 ApaH cl17219 -
superfamily 223712 433 585 1.56E-12 cl17219 ApaH superfamily - -
non-specific 163667 360 436 9.87E-10 cd07424 MPP_PrpA_PrpB cl13995 C
non-specific 163665 358 483 1.25E-08 cd07422 MPP_ApaH cl13995 C
non-specific 163614 358 429 8.42E-07 cd00838 MPP_superfamily cl13995 C
non-specific 107154 356 454 8.74E-06 PHA02239 PHA02239 cl17921 C
superfamily 107154 356 454 8.74E-06 cl17921 PHA02239 superfamily - C
non-specific 163668 359 484 9.05E-06 cd07425 MPP_Shelphs cl13995 C
non-specific 163666 355 429 1.74E-05 cd07423 MPP_PrpE cl13995 C
non-specific 163656 358 436 3.66E-05 cd07413 MPP_PA3087 cl13995 C
non-specific 163664 360 431 0.000369591 cd07421 MPP_Rhilphs cl13995 C
non-specific 236911 356 436 0.000388096 PRK11439 pphA cl18897 C
superfamily 236911 356 436 0.000388096 cl18897 pphA superfamily - C
multi-dom 197547 330 601 9.99E-104 smart00156 PP2Ac - -
multi-dom 185658 295 609 5.36E-78 PTZ00480 PTZ00480 - -
multi-dom 140271 302 594 2.44E-67 PTZ00244 PTZ00244 - -
multi-dom 173488 335 600 2.34E-65 PTZ00239 PTZ00239 - -
multi-dom 215750 355 563 5.38E-24 pfam00149 Metallophos - -
multi-dom 234673 358 483 6.18E-06 PRK00166 apaH - C
multi-dom 234457 355 438 4.08E-05 TIGR04075 bacter_Pnkp - NC
multi-dom 184187 356 483 0.000494631 PRK13625 PRK13625 - C
multi-dom 233082 360 483 0.00573897 TIGR00668 apaH - C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
specific active site D361,H363,D395,R399,N427,H428,H480,W514,H559 9 9 163662
specific metal binding site D361,H363,D395,N427,H480,H559 6 6 163662
 
DNA sequence
Upstream 1000 bp region from PH01000162G0280 gene.
AGCAATCTCCTAAGGATGTCAACATTTGGTTGAAAACTTCACCCATTATCACATAAAAAAAAAAGAAATCGTAACTCAGTTGAACCACCACGAAGATTGCTATTTTTGCACACATTTTATCCTATCCATTAGTACATTTTTCTCCTTGATTGCACAATTCTAACCTTAATATATATTGATTTAAGTATAGCTGCTAAACCCGTGATGGCCTGGAAAAAAAAATTACTTCAGCTGGTATTTGGGACACTGTTTATAGGGAAATGTTAAAAAAAAACCAGTGATTTTGGTGTGTGGGCCTGTACAGATAAATATGAACTCCTAAGATCTTGATAGGACATGCAGTTACTTATTTGGGATGTTCATGCCCAGCCAGGTAAACATGTTGTCGTACGAGCAATTAAAACTCGCCCTGATTTTGTATGTTTCCTTATTTTAGTTATGCGCCTACATCCTGCCGATTATAGTTTTGCATGCAAGATTTTGCAAAGAGGAATTGCACAACATTAATAGACATAATATGGTTAACTAGAATAGATCAGAGGTTTTTCAATGTAACAGTTATGCCCATTTCAAATATAGTACTTATTATCCTTAGTTGTATGTATTAGACTTATACTATGTTGCATCTTCGTATCTTCATAATGACCCCGTGTACTTATCCTTTTCTCATTAACATTAACATCCATAGATACGACATAATCGTGACCTTTTACGTTTCTCCATACGTTCTATCCTCGTTATTTTCTTTCTCCCGACTACAGTTACATTTATTCAACTTCGCATGCCAAGGGGCGCGCAGGTTTCTAGTTTTCTACATGGTCTGTTTGGTTCAAAGGAAAAGCCGGTATAACTCTCTTGAAATTCCGGTGCAATGATGCACTTTCATGAGCATTTCGAAGGAAAACTAACATTCGAAATTTCCCTTCGGGTCTATGCCGTATATGCCAAACAAGCAACGTGTATCACACAACTCATGTGTTTTTCTGGCGGACCAAATAGCT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGCAAATATTAATTAGAAAATGTTTAAAAGTGCATTATGCAGTCATAAATTCAAATTCAAATTTGAAAATTTTCGGCCGGCTACTGTTCATCCTGGTCCTCAACGGGTTTTCTGGTAACCGGCTGGTAACCGCCGGGATTTTGATCCTTGGCTATGCTACATTTAATGCAATTGCTATCACAGGTGTGCTGCTAGATGACCTCCTTGTTGCTGAAGATCTTGCTGCTGCTGAAACAACAAGTGCAGCTAACCATGCCGCTGCAGCCGCTAACATACAAGCTGGAGGAGCACCTGGCAGATATGCTTACAATGATGAACAAACAGGTGCAGAAACAACTCCTGATGGAGCTGTGGTTCTTGGAACTCTGGAACAAACAGGACAAACAGGTGCAGAAACAACTCCTGATGGAGCTGTGGTTCTTGGAACTCCGGTTGCTCCTCCTGTTAATGGGGACATGTATACCGATATCAGCCCTGAGAATGCCGTGATCCAGGGACAGAGGAGATTGAGCAAAGGTGTTGATTATTTGGTTGAAGCATCAGCTGCAGAGGCTGAGGCAATCAGTGCTACTTTAGCTGCTGCAAAGGCCAGGCAAGTTAATGGTGAGATGGAGCATTCGCCTGATGGGGAACAGTCTCCAAATGCCACAACATGTGGGAAGCAAAATTCAAGCCTCATCAAACCGGATCCTGCTCTTACGAATAATTCAACACCACCTCCTGGGGTTCGGTTACACCATAGAGCAGTTGTGGTAGCAGCAGAAACTGGAGGTGCCTTAGGTGGCATGGTTAGGCAGCTCTCCATTGACCAGTTTGAAAATGAAGGAAGAAGGGTCATCTATGGCACTCCTGAGAGTGCAACTGCAGCAAGGAAATTACTAGATCGACAAATGTCTATTAATAGTGTGCCCAAAAAGGTAATTGCGTCTCTCTTGAAACCTCGTGGTTGGAAGCCCCCTGTGCGAAGGCAGTTCTTCTTGGACTGCAATGAGATTGCAGATCTATGTGATAGTGCTGAAAGAATATTTTCAAGTGAACCAAGTGTCCTACAGCTTAAAGCTCCCATTAAGATATTTGGTGATTTGCATGGTCAATTCGGTGACCTCATGCGCTTATTTGATGAGTATGGTGCCCCTTCAACAGCAGGAGACATTGCTTACATTGATTATCTATTCTTGGGAGATTACGTTGATCGTGGTCAGCATAGTTTGGAGACTATCACTCTTCTCCTTGCACTGAAGGTTGAATATTCTCATAATGTACATTTGATTCGAGGAAATCATGAGGCTGCAGATATCAATGCGCTGTTTGGGTTCCGAATAGAGTGCATAGAGCGAATGGGTGAGCGAGATGGAATCTGGACCTGGCATCGCATGAATAGGTTATTTAATTGGCTTCCTTTGGCTGCCCTGATAGAAAAGAAAATAATATGTATGCATGGTGGTATTGGTCGGTCCATCAATCATGTAGAGCAAATTGAGAATCTTCAAAGACCGATTACCATGGAAGCAGGCTCAGTAGTTCTAATGGATCTTTTATGGTCCGATCCAACTGAGAATGACAGTGTTGAAGGACTCCGACCAAATGCTCGGGGCCCGGGTCTTGTTACCTTTGGGCCTGACCGTGTTATGGAGTTCTGCAACAACAATGACCTACAGTTGATCGTGCGAGCACATGAGTGTGTGATGGATGGCTTTGAGCGTTTTGCTCAAGGTCACCTGATCACTCTCTTCTCAGCAACAAATTACTGTGGTACCGCAAACAATGCAGGTGCAATCTTAGTTCTTGGTAGGGATCTTGTGGTTGTTCCAAAACTCATTCATCCTTTGCCACCTGCCATTACATCACCTGAGACCTCTCCAGAGCATCATATCGAGGACACATGGATGCAGGGAGCAAATCTAAGCGAAATAAGCATGAAGGGTGGAGAAGCTTTGGCAGTCGCCACCGACAGCGCTCTCCAAATTCTTTTCCCAAAACATGAGAAGTAG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000162G0280 gene.
GCAACAACCGCCAACACAGATTTATGGTTTTTGTAGCTTTTTGAGTAATATGATGAAAACCGTGCCTTGTTGAAATAGTGTTTCACGATGTGGCCATAATTGGTGAGATTCAGCCATAATATGGTGTAGCTCCGTTCAAATAAGAGGTCTTTTCACTCTGCTAACCCCAGTGTCAACTGTCAACCCTCAAGAAGAAATGTGGATACCAGAAGTTAACAGTGTTAAGAGTGTTGTTGGTTGTATATTCTCTCCCTCTCTTAGACCATATGGCCCATGTACTCTTCTCTATATATACTCTCCCATTAATGAATAAGATGCATAGTTGTGAATAGCAAAATCACTTTCCCCAAAATCTAACATGGTATCAGAGCTCTTCAACCCTAACCATAGCTCCTAGTTCCACCACCACCGCAGTCGTCTACTAGCAAGGTCTCTTCGCTCGGGCCGGTGGGCCTAAGCCGCTCTCGCTTCTTCCTTGCCCGACGGCGCATTGCTTCCGCTGCGGATCTTCTGCTTCCGCCGCCTCCTCGCCTGACGGCGCACGAGCTCGTCTCAACACCGCCGACACGAGCTTGTCTCTGTCGCCTCCTCTGGACCGGCGGGGAGCTCATCCTCGCGCACGCCGCCTCCCCTGCTCCCTCTAGACGCCGCATCCTCTGCTCCAGCGAGACCATCCAGCAGCTCCCTCTACGAACGAAGGACACTGCCTCCTCTGCTCTCGGTACAACTCAGCTCTGCCCTACTACTGCTGCTGTGTGCTCTTCTCTGCTACTGCTGTTGATGCTGTTACCGATGCTCTATTGTGCTTAGTACTATTGTGTGGTTGTGGTCCATCAAGATGGCAAAATCTAACACAATGTTTGGGGATAGTTCATCTCTTGTGTTCACGGACATCAAGCTTGATGGGTTAAACTACCGAGAATGGACTTTCTCAGTCAAGACTACTCTTAGGGGTTATGGTTTGGCCTCTCATTTGACTGACGACCCCTCTAATCCGAAGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000162 Download
Protein sequence
Protein sequence
MQILIRKCLKVHYAVINSNSNLKIFGRLLFILVLNGFSGNRLVTAGILILGYATFNAIAITGVLLDDLLVAEDLAAAETTSAANHAAAAANIQAGGAPGRYAYNDEQTGAETTPDGAVVLGTLEQTGQTGAETTPDGAVVLGTPVAPPVNGDMYTDISPENAVIQGQRRLSKGVDYLVEASAAEAEAISATLAAAKARQVNGEMEHSPDGEQSPNATTCGKQNSSLIKPDPALTNNSTPPPGVRLHHRAVVVAAETGGALGGMVRQLSIDQFENEGRRVIYGTPESATAARKLLDRQMSINSVPKKVIASLLKPRGWKPPVRRQFFLDCNEIADLCDSAERIFSSEPSVLQLKAPIKIFGDLHGQFGDLMRLFDEYGAPSTAGDIAYIDYLFLGDYVDRGQHSLETITLLLALKVEYSHNVHLIRGNHEAADINALFGFRIECIERMGERDGIWTWHRMNRLFNWLPLAALIEKKIICMHGGIGRSINHVEQIENLQRPITMEAGSVVLMDLLWSDPTENDSVEGLRPNARGPGLVTFGPDRVMEFCNNNDLQLIVRAHECVMDGFERFAQGHLITLFSATNYCGTANNAGAILVLGRDLVVVPKLIHPLPPAITSPETSPEHHIEDTWMQGANLSEISMKGGEALAVATDSALQILFPKHEK
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above