gene PH01000139G0960
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000139:690724 - 695261(+ stand)   Name
Alternate name Locus tag PH01000139G0960
Length of gene 4538  bp Length of CDS 1656  bp
Product information
Feature type
CDS
Product name
Transcription initiation factor TFIID subunit A containing protein
Alternate name
TAF12
Molecular weight
(predicted)
57587.5090200002  kDa
Isoeletric point
(predicted)
9.62662887573242
Length
551  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP01028350 PH01000139:691611 T T_G
PH01SNP01028360 PH01000139:691646 T T_C
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_186599 2
Please click OG5_186599 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os01g62820.1 Transcription initiation factor TFIID subunit A containing protein, expressed 3E-80
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 100 200 300 400 500 551
Detailed signature matches
    1. PF03847 (TFIID_20kDa)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR12264 (FAMILY N...)
  2. PTHR12264:SF3 (SUBF...)
GO term prediction

Biological Process

GO:0006352 DNA-dependent transcription, initiation

Molecular Function

GO:0046982 protein heterodimerization activity

Cellular Component

GO:0005669 transcription factor TFIID complex

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 112650 333 369 7.45E-06 pfam03847 TFIID_20kDa cl17384 C
superfamily 247938 333 369 7.45E-06 cl17384 TAF12 superfamily - C
non-specific 173964 331 369 3.25E-05 cd07981 TAF12 cl17384 C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic heterodimer interface L331,L332,K336,L340,Q343,V344,L358,I361,A362,D363,F365,I366,D367 27 13 173964
generic Heterotetramer interface D351,E353,V354,L357,E360,I361,D364 7 7 173964
 
DNA sequence
Upstream 1000 bp region from PH01000139G0960 gene.
GAACGACTAGGAGCCAATGACGCTGACGAGGCGATGCCTGCAGTAGCAGAGGAGGGCAACAGGGTGGTGGTCCACATGGCATGTGGTGACGACGTTGCTAGACCTGTTCATGGGTGGCCTGACCTAATTTTTCCAGGCTTGGGCCTTGATTTTCGGCTCGAAGCCCGGCCCGAAGCCCAAAAAAGCCTGAGAATGACAATAAAATAATAATAAATGTTTTTATTCTTGAAATGAATTAAATATTAATATTGATTCCAAGAAGAATTAAAATAATACAATTTCAAGGGAAAATCCAGTTTTCGGACTGGGCTAGGCTCGGGCCTGCCCATTCAAGGTTGGGTTTTTCTAGGCTTGTCCCGGAGTTTGAACAGGTCTAGACGCGGCCAAGATTGATGAGCGGGAGTGGCGGGGGAGGGGGGCTTCCTGAGATTGGGCCGAAGAAGGAGTGGCACGGCAAGAGATGGGGTGGCAGTGGCCATAGTCGGAGGCAAGAAGCAAGAAGAACCTTGGGAGGAAGAAGGGGAGGGGGGGGGCAAAAGGGTCATTTCATGTGTAGAGTTAACCAAAAAAAAGATTAAAATGATGCGAGCGTGGTAAATGCTAGAGAATAAGGGCTTGTTTGGTTGGTGTCCTGAATTTCATGCCTGAGAAAAAGTGATGCCTGGATGTAGCCTGGAAAGTAGATGATTTTTGCCTGACCAGGTAAACCTGAAGATGAGTTGTTTGGTTGGAAGCCTGTGTCTGGAATTGGTGAATGAAAAATAGACCGTTGGATCAAACAATCAACAGTGCGGATGGAACTGCCTGGCTCAGGCGTCCGTTTTTCACGCCTGCACTGGAGACCTGGCCTGGCTGAGAATGATGTGCAGGAAGTAATCCAAATAGCATCCGATTAATCTTCAGGCTACTGCTGGCGCCAGGCAATTTGGCCTAGGAAGCAATCCAAACACGCTCTAACAGTTTGAGCGGAGGCAAATCGTGCAGTGCCAATATGAGCGGTG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGATTTCCGGCCGCGGCCGCCTCAGCTGCAGGCGCCTTCGCCCACGCAGGCGGCGGTCGGCGCCTCGGGCTTCGGCCAGATCCACCGCTCGGGTTCGGCCTCCCGCCTCGCCGCTGTCGCCCAGCTTCCGCAGTACGCCGCGGCCAGGATGTACGGCGGGCAGATGAGCTTCTCGGGCGGCGGAGGGCAGGTGGGGCAGCAGCAGCTGGCAGCGCGCGCGGCCATGCTTGGGCAGGGGCAGCTGGGGATGCTGCAAGGGCAGGGCAACACGGCCTGTGCGGCGCACTACGGGCTCCAGTCACAAATGATGGCGCAGCCAAGGCAAAAGGGCATAGTACAAGGTGCACAATTTAATACTGCCAATGCAGCTCAAGCACTGCAAGGGATGCAGTCCATGGGAGTCATGGGTACTTTGGGGATGAACCAGATGAGACCAAATGGAACTACTCCATATGGTGCTCAACAACGTTTTGCCCATGCACAGATGAGGCCACAGCAAGCGTCGCAGCAAGCCGCACTATCTCCACAGAAGGTAGCTGGTCAAGGCTTGTTGAGAACAGCATTAAATTCACAACTACCTGGAGCATCGCAAAATGGACAGATGGTGCAAAATCTACCTCAGCAACAGCAGCCGCAGCAATGGTTGAAGCAAATACAATCATCGATGACCTCACCTGTTTCTTCACATCAACTTCAGCAGCAACAAAGGATTGTATTGATGCAACATTTACAGCAGAAGTCAGGATTGAGTCAACACCAAATTGCACTAGCCCAACAGCAGCATCCACATCTCAATGCCCAACAGATAATTCAGCAGCAACACATTCTGCAGCAACTTCAACAGCAGCAACAGCAACAATCTCCAAGGATATCAGCATCTGGTTCTCAGAAGTCCGCGAACTTGACAGGATCGCAACCAGGCACACCTTTGTCAAGTGGAACTATGGCTGGTGGAAGTGCGAGTCAAGGACCAGAAGGAACTAACCAACTTCTTGGGAAGAGAAAAATACAAGATTTGGTTGCACAGGTAGATCCCCTCGGCGAGGTTGATCCAGAAGTGGAAGATTTGCTTTTAGAGATTGCTGATGACTTCATTGACTCGATCCCTCGCAGCGAGATAGCTCATGCTCAAGCTCATGAGCTGTCAGGTGGCGGCCACGTACTAAGACCTTCACATCCTCATGTCGACAAAAGGGAGAGATGTGATAACGTCGCTGACCTCCACATGGAAGCTGTCGTACTCCACCGCACCAACGGCACAATATCGGCCGACAACGTGGTGAAGGGCATAGGCTTTGGCAGCACCACAACAGGCGTTGGCAAGACCGCGGCTGCCGCGGCATGCTCCGACAATGTCACCGTAGGCGCCGACAGGACCATGGCTGTGACTACCGTGCGGTGTGGTGCGGCAACAACTGCTGTAGGGCCTGCGCCGAGTAGACCGTCTCCTGGTACGGCGGCGACTGTCGTGAGGGCTGTGCCGAGCAAGTCGTCACTTGGTGCGATGGTCCCTGGCTCGCCCACCCTGACCTTGTTAATGATGATCAGTTGCGCCAAGATCTGCTTGAGCATGGCGTCAATCTCCTTGGGACTGGAACCATCGATGCCTGTCATGGTGGTCGCAGCGATTGGTTCTGATACCAAGTTGTTATAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000139G0960 gene.
ATAAATTTTCTATTTCTTTCTTGCTTACCCATAACTGATACAACGATGCCCCTATTATAGGGATGGTTTGACTTGACCCCAAAGAAACATGTATCTAATATAAGAAATAGATAATCCTAACAATCCAATCTAAAGGATATGGAAATAACAAATCTAAAGGATATGGAAATAACTAAAGATAACATCCCTAAATTTAAGGGATAAATGAGGGGTTTCCTTGGCCACAAAAGGCAAGAGTCGGCGATGTACGTGCTACAGTATCCCTGGATATTGTACCATAACATTCTTCTTCCGATTTTTGGTCATATTTTATCTGCTGGAGACATGTTGTGATTCAACTGACTTGGGTTTGTCATTAGGTAACTGCATTTGCGTGCAGCCTGGCAAAGCATAGGAAATCATCAGTTCTGGAAGCCAAGGATGTGTTGCTGCACCTAGGTTTGTAGCTGCACCTCCCTCCCTCTCTCTCTCTCATGTGCTACAAGCAATTTCTGTGCTTATATAATTCAAAATTAATTTCATGCAGAGAAAAATTGGCATTTGTCTGTTCCTGGTTTCTCGAGGGAGGATAAGAACCCACAAAGAAATCCTGTAAGATTAAGAGATCCTTTGTGATTACTTTTCTTCTTTATGAATTTGCCACAATGTTGTGGTTTCTTTATCTTCAGTACCTATGCATTTGTGCTATGCAACTTACTATGCAATCGTCCTGACTATTGTAGTGAATTTATTGAGTTTATTTTGTGGGCTTTCTGGGTAATCCCTCTCAAAGTTTAAACATTTAGCGGTTTATAGAATTTTAACTTCACAAAAGAGCATTTTATTCTAACAATTGACTCATGTTATCTGCTTGTTTTGTGACCATGACTGAACTGAATGTTGTCTATATGATTCTCAAAGTAGAAGCAACTGATGATAAGAGGTCTAGTAAATAAGCTGAATGTTCATTTCTATACTTTAGCATGTTGATACTAATGACTTTCACCTACTGCCGCCTTGGT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000139 Download
Protein sequence
Protein sequence
MDFRPRPPQLQAPSPTQAAVGASGFGQIHRSGSASRLAAVAQLPQYAAARMYGGQMSFSGGGGQVGQQQLAARAAMLGQGQLGMLQGQGNTACAAHYGLQSQMMAQPRQKGIVQGAQFNTANAAQALQGMQSMGVMGTLGMNQMRPNGTTPYGAQQRFAHAQMRPQQASQQAALSPQKVAGQGLLRTALNSQLPGASQNGQMVQNLPQQQQPQQWLKQIQSSMTSPVSSHQLQQQQRIVLMQHLQQKSGLSQHQIALAQQQHPHLNAQQIIQQQHILQQLQQQQQQQSPRISASGSQKSANLTGSQPGTPLSSGTMAGGSASQGPEGTNQLLGKRKIQDLVAQVDPLGEVDPEVEDLLLEIADDFIDSIPRSEIAHAQAHELSGGGHVLRPSHPHVDKRERCDNVADLHMEAVVLHRTNGTISADNVVKGIGFGSTTTGVGKTAAAAACSDNVTVGADRTMAVTTVRCGAATTAVGPAPSRPSPGTAATVVRAVPSKSSLGAMVPGSPTLTLLMMISCAKICLSMASISLGLEPSMPVMVVAAIGSDTKLL
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above