gene PH01000021G0560
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000021:314902 - 316050(- stand)   Name
Alternate name Locus tag PH01000021G0560
Length of gene 1149  bp Length of CDS 387  bp
Product information
Feature type
CDS
Product name
aquaporin protein
Alternate name
Molecular weight
(predicted)
13496.6156199999  kDa
Isoeletric point
(predicted)
9.59602737426757
Length
128  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
(0 result)
SNP ID Position Base in Scaffold Polymorphism
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_134379 5
Please click OG5_134379 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
Gene ID Short description Curator summary Computational description E-value
AT3G61430.2
plasma membrane intrinsic protein 1A
a member of the plasma membrane intrinsic protein subfamily PIP1. localizes to the plasma membrane and exhibits water transport activity in Xenopus oocyte. expressed ubiquitously and protein level decreases slightly during leaf development.
plasma membrane intrinsic protein 1A (PIP1A); FUNCTIONS IN: water channel activity; INVOLVED IN: response to water deprivation, response to salt stress, transport, water transport; LOCATED IN: plasma membrane, membrane; EXPRESSED IN: 22 plant structures;
7E-74
Best rice hit
(using MSU7)
(0 result)
Gene ID Product description E-value
 
Function (determined by interpro in EMBL-EBI)
Protein family membership
Domains and repeats
  1. Domain
1 20 40 60 80 100 128
Detailed signature matches
    1. PTHR19139 (AQUAPORI...)
    2. PF00230 (MIP)
    3. PR00783 (MINTRINSICP)
    1. SSF81338 (Aquaporin...)
Unintegrated signatures no IPR
Unintegrated signatures
GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

GO:0005215 transporter activity

Cellular Component

GO:0016020 membrane

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
non-specific 215807 10 115 6.69E-41 pfam00230 MIP cl00200 N
superfamily 241680 10 115 6.69E-41 cl00200 MIP superfamily - N
non-specific 238204 10 118 3.09E-35 cd00333 MIP cl00200 N
non-specific 233156 10 115 4.98E-30 TIGR00861 MIP cl00200 N
non-specific 223653 13 119 6.06E-21 COG0580 GlpF cl00200 N
non-specific 235453 13 117 7.44E-17 PRK05420 PRK05420 cl00200 N
non-specific 177664 23 119 1.39E-16 PLN00027 PLN00027 cl00200 N
non-specific 165733 10 115 8.73E-15 PLN00166 PLN00166 cl00200 N
non-specific 215085 19 119 4.37E-13 PLN00167 PLN00167 cl00200 N
non-specific 165748 12 108 4.06E-09 PLN00182 PLN00182 cl00200 N
non-specific 177778 23 117 3.35E-07 PLN00184 PLN00184 cl00200 N
non-specific 177663 12 120 4.80E-06 PLN00026 PLN00026 cl00200 N
non-specific 240230 22 119 9.69E-06 PTZ00016 PTZ00016 cl00200 N
non-specific 223653 20 112 0.000144553 COG0580 GlpF cl00200 C
non-specific 238204 22 112 0.000264981 cd00333 MIP cl00200 C
non-specific 233156 22 112 0.00441311 TIGR00861 MIP cl00200 C
non-specific 177663 20 85 0.00493733 PLN00026 PLN00026 cl00200 NC
multi-dom 215092 23 123 9.63E-10 PLN00183 PLN00183 - N
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic Asn-Pro-Ala signature motifs N77,P78,A79 6 3 238204
generic amphipathic channel G73,T74,N77,R80 8 4 238204
 
DNA sequence
Upstream 1000 bp region from PH01000021G0560 gene.
AGTGAGCAGAATTCAAGTGTTTNNNNNNNNNNCCCGCACCCTTGCTCTGTGATGTCCATGAGATGCTACTGTTAGTGTTGAGTATGCACTTTTATTGATTTTCCATGAGATGCTACTGTTAGCTGAAGAGCTTATGGCTCGGTTCCCCTCTCTCCCTTTTGTTGATTTTCGGATTTGATGAATGTTGCATCGGTAGAAAAACAATGTTGCATCTATAGAAAAAAAATGTTGCATACGGTTTACGGCGATGTTGTAATTTTTTCCAATGCCTTTTTTCTCCATATGCTTTGTTTTGATTTATGATGTTGCAACCATTGTCCGGTGACGTTGCAACCGTTATCCGATGATGTTGCAACCATTGTCCGGTGATGTTACAATTGTTGTCCAGCGATGTTGCAACTGTTATCTGGAGATGTTGCATTTTCAGACCATACGGGTGGGAGCCTCCACCGGTATGTCCGATTCCTAATCGCTCCCTAGATAAAAAGAATCGAAAGATCGATAAAGCTAGATAGCTTTTGTTAGAGTTAATCTTGTTTTTTTTTTTGAAATTTTTGTTAAGTTTTCATTTTTGTATAGGAAGTATTTTCCGTCTCTGTTTTCCGTTTTTTTAGCTAGTTTTCAAGTCGGCTCGTACGGGCGTATAGAAAGTTTATGAATATGTGCCTAAATCGGAGATTACATATAATAAGGCCCTGTACTCTATTTGAGATGTGACAAGTTGTGAGAAGAAATAAAAAAAAAAACCAAAAGAGAGCAGCAGCTCCAGATCGAGTGCCTCGGCGTCGTTCAGTGTTTTGCTCGTCTCTCCAGAAGAAAATAAGCACATCACGTGAAGCAAGAAGAGTACAGGGGTGCTGCTATCTTCATGTGAAGACAACCAGGAGGAGGGTCAAGTCGGGTGGATAGGGCGCAGGAGCAGCGGCCCCATGGAGAAAGCTTGGTGCCTGTCACGGCGTAAGAACCGAGTGCATCGTTTGTCTGAAAAGGAAGCTGATCGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGCAACGGCGGCGGCGCCAACGCCGTCAACCCAGGCTACACCAAGGGCGACGGCCTCGGCGCGGAGATCGTCGGCACCTTCGTGCTCGTCTACACCGTCTTCTCCGCCACCGACGCCAAGCGCAGCGCCAGAGACTCGCACGTCCCCATCCTTGCTCCTCTCCCGATTGGGTTCGCGGTGTTCCTGGTGCACCTGGCGACCATCCCCATCACCGGCACCGGCATCAACCCCGCCCGCTCCCTCGGCGCCGCCATCATCTACAACAGGAGCCACGCATGGAACGACCACTGGATTTTCTGGGTGGGCCCGTTCATCGGAGCTGCTCTGGCCGCCATCTACCACGTCGTGGTGATCAGGGCCATCCCCTTCAAGAGCCGCGACTAA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000021G0560 gene.
GCCATGAGCTCACGAAATGGAAGAACGGCATACTAAAATGAATAGTAGCTTGACTATCAACCAACAGAATCGGTGTTGATTCATTCTACTAGATGCACATAATCATGCTTGGTCATTCAACAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGCAATTTGTGCAATTTAGTTTTTGGGAGAGCACATAATCACTATTCTAATTTTACTCGTTAAGCAGTATAAAAAATTCGTAATATTAGGGCATTCAGACACAGTTAAGATACTATAATAACAGGAGGGGAAAAAAGATGAAATCGTACGCACCTCTACACCACCGATGCAAAAGATAACCACCAGAAGCTCCACAAACCAGTGAGACATCAGCTTGTAGAGCATTATCAAGAAACATGATGCGATCACAACGAACAGTATTGCCGATGTCATGTTGATATCTACCATACCACTAGAACCCCCGGTCTCAATGTTCAGTGAACTTTCATGTCCATCCTATATAAGTAGTGTGTCTGTTAGCTCCTCTTTTCAAGTAGACAAATGATAAAACACATAAGCTTTTGTTCAGAACCTTCAGGAGCTTCTCTTGTTCAATAACTGCTTCTCGAGCACTCCATGCTGACCAGTATGCTGCGCAAAGAATGGTACCAACAGCCATAAGCCATAGAAACACCTCTGCAGTATCAACCGGAGGACGATCTGGAGAGTATAGCCGCACTGAAACTGGGAAATTGAAAGCAAGAAATGTATATCTATTAGCTATCTTATGGTAAAATAAGTACCCAACTTTCAGTTAACACAAACATAAAGGTTAGACAATAAAGATAAGCACCCTCACATTCACAGGACATGGCACAAGA
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000021 Download
Protein sequence
Protein sequence
MGNGGGANAVNPGYTKGDGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRSHAWNDHWIFWVGPFIGAALAAIYHVVVIRAIPFKSRD
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above