gene PH01000010G3140
Feature Overview
Species moso bamboo (Phyllostachys edulis) Feature type gene
Genomic location PH01000010:2209593 - 2211280(- stand)   Name
Alternate name Locus tag PH01000010G3140
Length of gene 1688  bp Length of CDS 1071  bp
Product information
Feature type
CDS
Product name
heavy-metal-associated domain-containing protein
Alternate name
Molecular weight
(predicted)
37332.1177199999  kDa
Isoeletric point
(predicted)
8.63595199584961
Length
357  aa
Expression profiles
Expression status (Yes/No)
Yes
Heterozygous SNPs
As a diploid organism, heterozygous SNPs indicate different nucleotides at two bi-allelic loci on the same chromosome.
SNP ID Position Base in Scaffold Polymorphism
PH01SNP00136100 PH01000010:2210031 T T_G
PH01SNP00136110 PH01000010:2210096 A A_G
PH02SNP00000800 PH01000010:2209610 C C->G
Ortholog Groups (determined by OrthoMCL algorithm)
Group ID from orthomcl DB Counts Members of moso bamboo in this ortholog group
OG5_170116 4
Please click OG5_170116 (Group ID from orthoMCL DB) to find more information of orthologs in other species in this ortholog group, which represented species-specific gene expansion families in most of eukaryotic species.
Comparative genomics
Best arabidopsis hit
(using TAIR10)
(0 result)
Gene ID Short description Curator summary Computational description E-value
Best rice hit
(using MSU7)
Gene ID Product description E-value
LOC_Os03g05750.1 heavy-metal-associated domain-containing protein, putative, expressed 2E-43
 
Function (determined by interpro in EMBL-EBI)
Protein family membership

None predicted.

Domains and repeats
  1. Domain
1 50 100 150 200 250 300 357
Detailed signature matches
    1. SSF55008 (HMA, heav...)
    2. PS50846 (HMA_2)
    3. PF00403 (HMA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PTHR22814 (COPPER T...)
GO term prediction

Biological Process

GO:0030001 metal ion transport

Molecular Function

GO:0046872 metal ion binding

Cellular Component

None predicted.

You may use PPI function to find protein-protein interactions network about moso bamboo.
Pathways (All the pathways are obtained from KEGG)
(0 result)
KEGG orthology Functional Subsystem Pathway
You may use Pathway function to find more information for detail.
Reactions (All the pathways are obtained from KEGG)
(0 result)
ID for KEGG orthology Reaction description EC number
Structure features (determined by CDD in NCBI)
Conserved domain models
Type PSSM-ID Start Stop E value Accession Short name Superfamily Incomplete ?
specific 215902 147 210 3.75E-06 pfam00403 HMA cl00207 -
superfamily 241686 147 210 3.75E-06 cl00207 HMA superfamily - -
specific 215902 18 79 0.000390415 pfam00403 HMA cl00207 -
superfamily 241686 18 79 0.000390415 cl00207 HMA superfamily - -
non-specific 238219 24 45 0.00178045 cd00371 HMA cl00207 C
Conserved sites/feature
Type Brief name Coordinates Complete size Mapped size Source domain
generic metal-binding site L24,H25,C26,C29 4 4 238219
 
DNA sequence
Upstream 1000 bp region from PH01000010G3140 gene.
AGTACTAACAAACTCGTAATTCAGCCAGAATTGAAGATTCAGAAGATAACGTAGTAAAAACGAAAGCCTTTCGATTTACCGACGCATTGGAGCTCTTCTTTCTTGTCCCAAATGTCAAAAAAGGATGTGAATAAGAGAAACGACGGCCTGCACACGCACAGCCAGGCTTCACATCAAAAAAAGGATGTGCATGATCTTTCACAAATCAAGCTCTATCAGCCGCAATGTAGCTAGCACACAGAGAAAATATCAAAATAATATCGTCAGAGAGAATTCATACACGGGAGAATATCTGGACCGACGTAGCTGTCTATCCTCCTGGACGCCACGTCGGACGGGGGAGAACAAGACAAAATTTACCGCCACGGCGAATCGTTACCGCCGCGGTCGGAAAATCAAAATATTCTCTGCGTTCGGAGAATTTCTTGTTCGTCACGAACAGCACAGAACAACGAGGATTTACTCGGATTTTAATTGTATCACAACGTCTCCGATAAAGTAACGGCGACGAAGACAAACCAGTCCACATTCAGCATCTCTGACCACTCATTCGGATCTAGGAAAATAAATTCTATGAGGTCCTCCCTCTCCAAAGACTCCTCCATGATCTCTATCCACTCACCCCACCCCCCTATCCAACGGCCCGGGGGAGAGGCCTCACATGATACCCTCCCCCAGGGAATTTCTTTCCCGGATCTAGCACTTTGCGACCAATTCATCTCGCTCATATGCTAATACCAGTTAAATCAAATTAAACCAATGGAGTAGCACAGACATTGATCAGGACGTACGCTGCAACAAAAGGGACAGATTGATCAAAATTTGATCGGGCGCACGCATCGCTGGATGCTTCTGAATTTTGATTACCACCACGTCTCTGATAAAGTAACGGCGACGAAGACAAACCAGTCCACAATTCAACGTCTCTGACCAGGCATTCGGAACTAGCACTTTGCGACCAATTCATCTCGCTCATATGCTAATACCAGTTAAATCAAATT
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
CDS sequence
ATGGGGGAGGAGAAGGCTCCCAAGGGCGGGGACGCCGAGCCGCCGCAGCCGGTCGTCCTCAGGATGGAGTTGCATTGCGCCGGCTGCGCGAAGAAGGTCAAGAAGTACATCAAGCACCTGCCTGGGGTGGAGTCGGTCGTGGCGGACGCGGCGGCGAACAGGGTCGTCGTGGCGGGGACGGCCGACGCGGCCGCGCTCAAGGCGCGGATCGAGGCCAAGACCAATAAGGCCGTCGAGATCGTCTCCGCCGGCAGCGGCGGCCCCAAGAAGGCCGCCGCCGAGTCAAAGGCCGACAAGGGCGGCGGTGCCGGCGGCGGAGAGAATAAGAAGGCCGACAAGGACGGCGCCGGCGAGAAGAAGGGGGACAAGGACGCCCAGCTGAAGGAGGAGAAGGAGCAGAAGCAACCGCCCGAGGAGAAGAAACCCAAAGAGGAGACGGTGCTGCTCAAGATTCGCCTCCACTGCGACGGCTGCGCCGACCGCATCAGGCGACGCATCTACAAGATCAAAGGTGTGAAGGATGTGGTACTGGACAGCAACGGCAAGGATGAGGTGAGGGTCACGGGCACGATGGACGTCGCCGCCATGCTGGTTTACCTCAAGGAGAAGCTCAACCGCACCGTGGAGGCCGTGGCACCCGGCAAAAAAGACGGCGGCGACGAGAAGAAATACGTCGATAAGGACAAAGGCGGCGACGGCGACAAGAAGAAAGACGCGGCAGCCGCGGGCGGCGACGACAAGAAGGGCACAGGCAAAGGCATCGAGGCGGCGGGCCCGTCCAAGGCGGCTGCTGCCGCGTTCATGGCCCCTCCGCCGGCCGAGGCGAGCACGTACCACGTGTCGCCATACGGGTACGTCGCGTACACGCAGGCCCCCCCCGCCAGCTACTACCACTACTACGGCGGCAATGCCGACGGCGCGGGGCATGCCAACCCCAACGGCGCCACCGACTACCCCCACCACCCCAACGCCAACGCAAACCCCAACCCCCCGCCGTATCCGTACGGCTTCGACATGGCGCCGGCGCCGCAGCTGTTCAGCGACGAGAACCCCAACGCCTGCTCCGTCATG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Downstream 1000 bp region from PH01000010G3140 gene.
GACGAAGGGAGGAAATGCCAATGGGGGTGGGCTAAATAGGACGAGGTGGAGGCGGAGGAGGCAGAGAGAGAAACAACCGATTATTGCCACGTGCTGCGGTGGGCCCAGGTTGTCAGGCAGTGCTGATCCACAACCGCGTCAGAGTCAAACTAGTACTACTACTCGAAGTTTCTCCTGCCCGGTCGCAGATGCCGGTAAATTCCTGCCAGCCTGCAGTGCTGCTGCTGCATTTGGCTCTGAGTGCTGTGTCCGGTCACCTCGGACGTCAGAAGTGGCGTCAGCGCGCAGCACTTTCCTTCCTCTGCTGCTGCTGTTGCTGCGAGGATTAGCACTTACCCACTGACAAAAACGAGCACCGCTATTATTTACCCGCAATTGTAATAACGGATTTGCTGCTGTTCAGCGTCTGAAATTTTGTGATAGTTTAGTCGATTTTGTGACCGTCAAATCTTGCTTTAAGACGTGTATAATGGCTGATATGATTAACGGGCCTGATCTACGTTATTAGTCAGTTTTTTGTTTAATTTTGGATGAAAATCTAACGGTGAGGAAAATTGATTGAAAAATTATAATTTTTCAGGCAACTTACAATTAGACAATCCCAATAAATGATTTTTTTTCTCGCGAGGGAAGTAATAAATGGATTTATGAACATTACTGTTACCATTGTCACTGGGAAATTGGGAATGGCTTAATTGGGCAGGTACTACAGGCTATATTTATCACAACAGATCTCACCAAATCAAGAGGGATCGATGAGAGACTCACTGCCCATCAAATCATTCCTTTATAATAGTAAGGGCGGGAGTGTAGCGTGAAGGAAAATGGCACTGTAGCTGTGCAAACGTCCAAAATCCATGGCCATTTGAGAAGAGGGATAGGAGCCTCTCCAATCAAAGGTGAAAACAGCCGTAGTTTCGTACGATGTTTGCTGCTGTTTCCGCTTTAGTTTTCTATTAACTATAACCCTCACGTACGGCGATTGCGTCGAAGAAATGATG
Copy to clipboard
BLAST search against this genome or other genomes in database  
Need more than 1000 bp? Try sequence retrieval tool or view intergenic regions in GBrowse.
Scaffold PH01000010 Download
Protein sequence
Protein sequence
MGEEKAPKGGDAEPPQPVVLRMELHCAGCAKKVKKYIKHLPGVESVVADAAANRVVVAGTADAAALKARIEAKTNKAVEIVSAGSGGPKKAAAESKADKGGGAGGGENKKADKDGAGEKKGDKDAQLKEEKEQKQPPEEKKPKEETVLLKIRLHCDGCADRIRRRIYKIKGVKDVVLDSNGKDEVRVTGTMDVAAMLVYLKEKLNRTVEAVAPGKKDGGDEKKYVDKDKGGDGDKKKDAAAAGGDDKKGTGKGIEAAGPSKAAAAAFMAPPPAEASTYHVSPYGYVAYTQAPPASYYHYYGGNADGAGHANPNGATDYPHHPNANANPNPPPYPYGFDMAPAPQLFSDENPNACSVM
Copy to clipboard
BLAST search against this genome or other genomes in database  
 

* This site recommends the best viewd with 1024x768 in IE8 or above